KEGG   Mycobacterium smegmatis MC2 155: MSMEG_4956Help
Entry
MSMEG_4956        CDS       T00434                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MSMEG_4956 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MSMEG_4956 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MSMEG_4956 (thrC)
Enzymes [BR:msm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MSMEG_4956 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5052675..5053757)
Genome map
AA seq 360 aa AA seqDB search
MSAAKAAVHQPWPGLIEAYRDRLPIGDDWTTVTLLEGGTPLIHAKRISELTGCTVHLKVE
GLNPTGSFKDRGMTVAVTESLARGQQAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI
AMGKLAQAVMHGAKIIQVDGNFDDCLELARKLTADFPTIALVNSVNPYRIEGQKTAAFEI
VDALGTAPDVHALPVGNAGNITAYWKGYSEYHRDGVSDRLPRMLGTQAAGAAPLVTGAPV
KDPETIATAIRIGSPASWNSAVEAQQQSDGRFLAATDEEILAAYHLVARTEGVFVEPASA
ASIAGLLKSVEDGWVKRGSTVVCTVTGNGLKDPDTALKGMPQVTPVPVDPSAVVAELGLS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcagcaaaggctgcggtgcaccagccctggccgggcctgatcgaggcctaccgg
gaccggctgccgatcggtgacgactggaccaccgtgacgctgttggagggcggtaccccg
ctgatccacgccaagcggatcagtgaactcaccggctgcacagtgcatctcaaggtcgag
gggctcaaccccaccggctccttcaaggaccgcggcatgaccgtggccgtcaccgagtcg
ctggcccgcggccagcaggccgtgctgtgcgcgtcgaccggcaacacctccgcgtcggcg
gcggcctacgccgcgcgcgcaggcatcacgtgcgccgtgctgatcccgcagggcaagatc
gccatgggcaagctggcgcaggcagtcatgcacggcgccaagatcatccaggtcgacggc
aacttcgacgactgtctcgagctggcccgcaaactcaccgccgacttcccgaccatcgcg
ctggtgaactcggtcaacccgtaccgcatcgaggggcagaagaccgcggcgttcgagatc
gtcgacgcgctgggcaccgctcccgacgtgcacgcgctgccggtcggcaacgcgggcaac
atcaccgcgtactggaagggctactccgagtaccaccgtgacggcgtctccgaccggttg
ccgcgcatgctcggcacgcaggccgcgggcgcggcgccgctggtgaccggcgcgccggtc
aaggatcccgagaccatcgccaccgcgatccgcatcggctcgcccgcgtcgtggaactcg
gccgtggaggcccagcagcagtccgacggccggttccttgccgcgaccgacgaggagatc
ctggccgcctaccacctggtcgcccgcaccgagggtgtgttcgtcgaaccggcgtctgcc
gcgagcatcgcgggcctgctcaagtcggtcgaagacggttgggtcaagcgcggttccacc
gtggtgtgcaccgtgaccggcaacggtctcaaggatcccgacaccgcgctcaagggcatg
ccccaggtcacccccgttcccgtcgacccgtccgcggtggtcgccgagctgggtctgagc
tag

DBGET integrated database retrieval system