KEGG   Mycobacterium smegmatis MC2 155: MSMEG_5185Help
Entry
MSMEG_5185        CDS       T00434                                 

Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
msm00071  Fatty acid degradation
msm00280  Valine, leucine and isoleucine degradation
msm00281  Geraniol degradation
msm00310  Lysine degradation
msm00360  Phenylalanine metabolism
msm00362  Benzoate degradation
msm00380  Tryptophan metabolism
msm00410  beta-Alanine metabolism
msm00627  Aminobenzoate degradation
msm00640  Propanoate metabolism
msm00650  Butanoate metabolism
msm00903  Limonene and pinene degradation
msm00930  Caprolactam degradation
msm01100  Metabolic pathways
msm01110  Biosynthesis of secondary metabolites
msm01120  Microbial metabolism in diverse environments
msm01130  Biosynthesis of antibiotics
msm01212  Fatty acid metabolism
Module
msm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MSMEG_5185
   00650 Butanoate metabolism
    MSMEG_5185
  Lipid metabolism
   00071 Fatty acid degradation
    MSMEG_5185
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MSMEG_5185
   00310 Lysine degradation
    MSMEG_5185
   00360 Phenylalanine metabolism
    MSMEG_5185
   00380 Tryptophan metabolism
    MSMEG_5185
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MSMEG_5185
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MSMEG_5185
   00281 Geraniol degradation
    MSMEG_5185
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MSMEG_5185
   00627 Aminobenzoate degradation
    MSMEG_5185
   00930 Caprolactam degradation
    MSMEG_5185
Enzymes [BR:msm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MSMEG_5185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 4531303
NCBI-ProteinID: YP_889431
UniProt: A0R2P3 I7FJI9
Position
5284871..5285698
Genome map
AA seq 275 aa AA seqDB search
MTSTDASAETVTRDYPSIDDVSVSLTDGVLAVTLNRPDSLNSLNRDMLDAVADAMEVAAT
DPAVRVVRLGGAGRGFSSGAGISEEDQNAKGHDAAAVLDAANRAVAAIVALPKPVVAVVH
GPAAGVGVSLALACDIVLASDQAFFLLAFTKIGLMPDGGASALVAAAIGRIRAMRLALLA
DRLTATDAYDWGLISAVYPADEFDAAVDKVLAKLRNGPAVALRKTKQAINEATLTELDDA
IAREREGQLELLVANDFREGAQAFQQNRRPEFTDQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgacttccaccgatgccagtgccgagaccgtgacccgcgattaccccagcatcgacgac
gtttcggtatcgctcaccgacggtgttctggcggtgacgctcaaccgccccgacagcctc
aactcgctcaaccgggacatgctcgacgcggtcgccgacgccatggaggtcgccgcgacc
gatccagctgtgcgcgtcgtgcgcctcggtggcgccggccgcgggttcagctcgggtgcc
ggcatcagcgaggaagaccagaacgccaagggtcacgacgccgcggccgtgctcgatgcc
gccaaccgcgccgtcgctgcgatcgtggcgctgccgaaacccgttgtcgccgtggtgcac
gggccggccgcaggcgtcggcgtgtcgctcgcgttggcgtgcgacatcgtactcgcgtcg
gatcaggcgttcttcctgctggcgttcaccaagatcggcctgatgcccgacggcggcgcg
tcggcgctggtcgcggcggccatcggtcgcatccgcgcgatgcgcttggcgctgctggcc
gaccggctgaccgccaccgacgcctacgactggggcctgatcagcgccgtgtacccggcc
gacgagttcgacgcggccgtcgacaaggtgctggcgaagctgcgcaacgggcccgctgtc
gcgctgcgcaagaccaagcaggcgatcaacgaagcgacgctcaccgagctggacgacgcg
atcgcgcgtgagcgcgagggacagctggagttgttggtggccaacgacttccgtgaaggc
gcgcaggcgttccagcagaaccggcgcccggagttcacggaccagtag

DBGET integrated database retrieval system