KEGG   Mycobacterium smegmatis MC2 155: MSMEG_5471Help
Entry
MSMEG_5471        CDS       T00434                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MSMEG_5471 (galU)
   00052 Galactose metabolism
    MSMEG_5471 (galU)
   00500 Starch and sucrose metabolism
    MSMEG_5471 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    MSMEG_5471 (galU)
Enzymes [BR:msm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MSMEG_5471 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5553543..5554439)
Genome map
AA seq 298 aa AA seqDB search
MSIPHTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAEAGAERLVIVTSEG
KDGVVAHFVQDLVLEGTLEARGKKTMLEKVRRAPALIKVESVVQAEPLGLGHAVSCVESV
LAADEDAISVLLPDDLVLPTGVLETMSKVRAKRGGSVLCAIEVPGDKISAYGVFDVETVP
DAANPNVLRVKGMVEKPRPEDAPSHFAAAGRYVLDRAIFDALRRVPRGTGGEIQLTDAIA
LLIEEDHPVHVVVHRGARHDLGNPGGYLKAAVDFALERDDYGPELRQWLVERLGLAEK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgattcctcataccgcagtcgtcccggcggccggtctgggaactcgtttcctgccg
gcaaccaagactgtgcccaaagaactgttgccggtcgtcgacacgcccggtatcgaactc
gtcgcggcagaggccgccgaggccggcgcggagcgcctggtcatcgtcacgtccgagggc
aaggacggtgtcgtcgcgcacttcgtccaagacctggtgctggagggcaccctggaagct
cgcggcaagaagaccatgttggagaaggtccggcgcgcgcctgccctgatcaaggtcgaa
tcggtggtgcaggccgagccgctgggcctcggccacgccgtgagctgcgtcgagtccgtc
ctggctgccgacgaggacgccatctcggtgctgctgcccgacgacctggtgttgcccacc
ggcgtgttggagaccatgtcgaaggtgcgggccaagcgcggcggctcggtgctgtgcgcg
atcgaggtgcccggcgacaagatcagcgcctacggtgtcttcgacgtcgaaaccgtgccc
gacgccgccaacccgaacgtgctgcgggtcaagggcatggtcgagaagcccaggcccgag
gacgcgccgtcgcacttcgccgcggccggccgttacgtgctggaccgcgcgatcttcgac
gcgctgcgccgcgttccccgcggtaccggtggcgagatccagctgaccgacgccatcgcg
ttgctgatcgaagaggaccatcccgtgcacgtggtggtgcaccgcggtgctcgacacgac
ctgggaaatcccggcggctacctgaaggctgcggttgactttgcgttggaacgtgacgac
tacggcccagaactgcggcagtggttggttgagcgactgggcttggcagagaagtga

DBGET integrated database retrieval system