KEGG   Mycobacterium smegmatis MC2 155: MSMEG_5508Help
Entry
MSMEG_5508        CDS       T00434                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MSMEG_5508
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    MSMEG_5508
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MSMEG_5508
Enzymes [BR:msm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MSMEG_5508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(5593079..5594662)
Genome map
AA seq 527 aa AA seqDB search
MPDTDRLIISRRTLLRASLAGALLVPAAACGTPSSAPSSTGLIANRPRLTHGVATGDPRP
DGALVWARADEPARMIVETAATESFSNPNRIEGPQLTPESDGTGRVRITGLEPGQTVHYR
VTLEGEDGATSEPVTGVFKTVPTQAQDITFVWGGDVVGQGWGINKQGGMSIFGAMADRNP
DFFIHSGDAIYADGPVPETQKRNDGGMYVNLTDPAKDHVAQTLADYRGNYAYNLTDQHYR
RFNATVPQLIQWDDHEVINNWFPHESLVGQGRAGYTETDVDKLAGYAYQAWREWQPVDPS
EAVDGRLYRKVSYGPLLDVFVLDMRTYKNPNPQAWATSDDDGILGREQTQWLINGLKNST
AAWKIVANDLPISIVVPDKATNPEQGPASMEAVAQGDNGRPLGREIAFSRILSATKDVRN
IVYLTADVHYTAAISYHPDRAAFGDFTPFWEFVSGPLNAGAFPQSPLDGTFGPRYEFVHA
PEVENTSPAEGFQHFGEVHIDSDTRVLTVNLRDATGKSLYSTDLAPA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacaccgaccgtctgatcatctctcgtcgtaccctgctgcgcgcgtccctggcc
ggggcgctgctggtgcccgccgcggcgtgcggcacgccgagcagcgcgccgtcgagcacc
ggtctgatcgccaaccggccgcggctgacccacggcgtcgccaccggagatccccgcccc
gacggtgcgctggtgtgggcacgtgcggatgagcctgcacgaatgatcgtcgaaaccgct
gccaccgaatcattctcgaatccgaatcgcatcgagggcccgcaactgaccccggagtcc
gacggcaccgggcgcgtgcgcatcacaggcctggagccggggcagaccgtgcactaccgc
gtcaccctggaaggcgaggacggcgccacctcggaaccggtgaccggcgtgttcaaaacc
gttcccacacaagcacaggacatcacatttgtgtggggcggtgacgtcgtcggacaaggc
tggggcatcaacaagcagggcgggatgtcaatcttcggtgcgatggccgaccgcaacccg
gacttcttcattcactccggtgacgcgatctatgccgacggtcccgtgccggagacgcag
aaacgaaacgacggcggtatgtacgtcaacctcaccgacccggccaaggatcatgtggcg
cagacacttgccgactatcgcgggaactacgcctacaacctcaccgaccagcactaccgg
cgcttcaatgccactgtgccgcagttgatccagtgggacgaccacgaggtgatcaacaac
tggttcccgcacgagtcgctggtgggccaggggcgtgcgggttacacggaaaccgacgtc
gacaaactcgccggctacgcgtaccaggcgtggcgcgaatggcagcctgtggacccgtcc
gaagcggtcgacggccgcctgtaccgcaaggtgtcctacgggccgctgctcgacgtgttc
gtgctcgacatgcgcacctacaagaacccgaacccgcaggcgtgggccacgtcggatgac
gacgggatcctggggcgcgagcagacgcagtggctcatcaacggtctgaagaactcgacg
gccgcgtggaagatcgtcgccaacgatctgccgatcagcatcgtggtcccggacaaagcg
accaaccccgagcaggggcccgcgtcgatggaggccgtcgcgcagggtgacaacgggcgt
ccgctcggacgggagatcgcgttctcccggatcctgtccgcgaccaaggatgtgcggaac
atcgtctacctcaccgccgacgtccactacaccgcggcgatctcgtaccacccggatcgg
gctgcgttcggcgacttcacgccgttctgggaattcgtctccgggccgctgaacgccgga
gcgttcccgcaaagcccgctcgacggcacgttcgggcctcgctacgagttcgtccacgcg
cccgaggtggagaacacctcgccggccgagggattccagcacttcggtgaggtgcacatc
gactctgacacccgggtgctgacggtcaacctgcgcgacgccaccggaaagtcgttgtac
agcacagacttggctccggcatag

DBGET integrated database retrieval system