KEGG   Mycobacterium smegmatis MC2 155: MSMEG_5512Help
Entry
MSMEG_5512        CDS       T00434                                 

Definition
magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MSMEG_5512
Enzymes [BR:msm01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MSMEG_5512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(5598646..5600031)
Genome map
AA seq 461 aa AA seqDB search
MVSQPKDLPRTVGELRASGHRERGVKAEIRENLLAALAERRDVWPGILGFEDTVIPQLER
ALIAGHDVVLLGERGQGKTRLLRALTGLLDEWTPVIAGSELGEHPYSPITPESIRRAADS
GDDLPVEWRHRSERYTEKLATPDTSVADLVGDIDPIKVAEGRSLGDPETIAYGLIPRAHR
GIVAVNELPDLAERIQVAMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGRIIT
PLKDRFGAEIRTHYPLELEAEVGVIRQEAELAAEVPEYLLAVLARFARNLRESNSIDQRS
GVSARFAIAAAETVAASARHRAAILGEDDPVARVVDLGTVIDVLRGKLEFETGEEGREQA
VLEHLLRRATADTAQRLLGGIDVGPLVAAIEEGSPVTTGERVSAKDVVAALPDLPAIDAI
AHRLNAVSVGQRAAAIELALEALYLAKRIDKVSGEGETVYG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtggtgagtcaaccgaaggatctgccccgcacggtcggtgaactgcgagcttccgggcac
cgcgaacggggtgtgaaagccgaaatccgggaaaacctgctggccgcgctggccgagcgc
cgcgatgtttggcctgggattctcggcttcgaggacaccgtgatcccgcagctcgaacgg
gccctgatcgccgggcacgacgtggtgttgctgggcgagcgcggtcagggcaagaccagg
ctgctgcgggcgctgaccgggctgctcgacgagtggacacccgtgatcgcgggttccgaa
ctgggcgagcatccctacagccccatcacgccggagtcgatccgccgtgcggccgactcc
ggtgacgacctgcccgtcgagtggcgtcatcgcagcgagcgctacaccgagaaactcgcg
acgcccgacaccagcgtcgccgacctggtgggcgacatcgacccgatcaaggtcgccgaa
gggcgcagcctgggtgaccccgagaccatcgcctacgggctcatcccgcgggcgcaccgc
ggcatcgtggcggtcaacgaacttcccgacctcgccgagcgcatccaggtggcgatgctc
aacgtgatggaggagcgcgacatccaggtgcgcggctacacgctgcggctgccgctcgac
gtgctcgtcgtcgccagcgccaacccggaggactacaccaaccgcgggcgcatcatcacc
ccgctcaaggaccggttcggcgccgagatccgcacgcactacccgctggaactcgaggcc
gaggtgggcgtcatccggcaggaggccgaactcgcggccgaggtgcccgagtacctgctc
gccgtgctcgcccggttcgcgcgcaatctccgtgagtcgaactcgatcgaccagcgttcg
ggtgtgtcggcgcggttcgcgatcgccgcggccgagaccgtcgcggcctcggcgcggcac
cgcgcggccatcctcggtgaggacgatccggtggcccgtgtggtcgacctcgggaccgtg
atcgacgtgttgcgcggcaaactcgaattcgagaccggcgaagaaggtcgggagcaggcc
gtgctggagcatctgctgcgccgcgccacggccgacaccgcgcagcgcctgctgggcggt
atcgacgtcggcccgctcgtcgcggcgatcgaggaaggctccccggtgaccaccggtgag
cgcgtctccgccaaagacgttgtggcggcgctgccggacctgcccgccatcgacgccatc
gcgcaccgcctcaacgcggtgtcggtgggccagcgtgccgccgcgatcgaattggcgctg
gaggcgctgtatctggcgaaacggatcgacaaggtgtccggggagggcgagaccgtctat
ggctga

DBGET integrated database retrieval system