KEGG   Mycobacterium smegmatis MC2 155: MSMEG_5525Help
Entry
MSMEG_5525        CDS       T00434                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSMEG_5525 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MSMEG_5525 (sucC)
   00640 Propanoate metabolism
    MSMEG_5525 (sucC)
   00660 C5-Branched dibasic acid metabolism
    MSMEG_5525 (sucC)
Enzymes [BR:msm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MSMEG_5525 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(5614853..5616016)
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQAKELFAKHNVPTSPGRVTDSAEDAKTIAEEIGRPVMVKAQVKTGGRGKAGGVK
YAATPDDAFTHANNILGLDIKGHVVKKLLVAEASDIAEEYYISFLLDRANRTYLAMCSVE
GGMEIEEVAATKPERLAKVPVDAVKGVDLAFARSIAEQGHLPAEVLDAAAVTIQKLWEVF
VKEDATLVEVNPLVRTPDDQILALDGKVTLDENAGFRQPGHAEFEDRDATDPLELKAKEN
DLNYVKLDGQVGIIGNGAGLVMSTLDVVAYAGENHGGVKPANFLDIGGGASAAVMAAGLD
VILGDSQVKSVFVNVFGGITACDAVANGIVQALQILGDEANKPLVVRLDGNNVEEGRRIL
AEANHPLVIQAETMDAGADKAAELANK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatctcttcgaataccaggcgaaagagctgttcgccaagcacaacgtcccgacatca
cccggccgggtgaccgattccgccgaggacgccaagacgatcgccgaggaaatcggccgc
cccgtgatggtgaaagcccaggtcaagaccggtggtcgcggcaaggccggtggcgtgaag
tacgcagccacccccgatgacgcgttcactcacgcaaacaacatcctcggcctcgacatc
aagggccacgtggtcaagaagttgctcgtggccgaggcgagcgacatcgccgaggagtac
tacatctccttcttgctcgatcgcgccaaccgcacctacctggccatgtgctcggtcgag
ggtggcatggagatcgaggaagtggccgccaccaagcccgagcgtctcgcgaaggttcct
gtcgacgccgtcaagggtgtcgacctggcgttcgcccgttcgatcgccgagcaaggccac
ctgcccgccgaggtgctcgacgccgccgcggtgaccatccagaagctgtgggaggtgttc
gtcaaggaggacgccaccctggtggaggtcaacccgctggtgcgcacccccgacgatcag
atcctcgccctcgacggcaaggtcaccctcgacgagaacgccggcttccgtcagcccggc
cacgccgagttcgaggaccgcgacgccaccgatcctcttgagctcaaggccaaggagaac
gacctcaactacgtcaagctcgacgggcaggtcggcatcatcggcaacggcgccggtctg
gtcatgtcgacgctggacgtcgtcgcctacgcgggtgagaaccacggcggcgtgaagccc
gccaacttcctggacatcggcggtggcgcctcggccgccgtgatggccgcgggtctggac
gtcattctgggcgacagccaggtcaagagcgtgttcgtcaacgtcttcggtggcatcacc
gcgtgtgacgccgtcgccaacggcatcgtgcaggccctgcagatcctgggcgacgaggcc
aacaagccgctggtcgtgcgtctggacggcaacaacgtcgaagagggccggcgcatcctg
gccgaagccaaccaccccctggtcatccaggccgagaccatggacgccggtgccgacaag
gccgccgagctggcgaacaagtaa

DBGET integrated database retrieval system