KEGG   Mycobacterium smegmatis MC2 155: MSMEG_5545Help
Entry
MSMEG_5545        CDS       T00434                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:msm03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(5634240..5635106)
Genome map
AA seq 288 aa AA seqDB search
MPELPEVEALADHLRRHAVGRVVSRVDVSALSVLKTFDPPVAALHGSTVTAAHRWGKYLG
MEVESGGAPLHLITHLSRAGWLRWSDKLAPTPLKPGKGPIALRVHLGDSQGFDLTEAGTQ
KRLAVWVVRDPMDVPQIASLGPDALSLDSTALAGVLAGNSGRIKTVITDQKVMAGIGNAY
SDEILHVAKLSPFTTAGKLTDAQLGALHDAMITVLTDAVSRSVGQQAATLKGEKRSGLRV
HARTGLPCPVCGDTVREVSFADKSFQYCPTCQTGGKVLADRRMSRLLK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactgcccgaggtcgaggcactggccgatcacctgcgccggcacgcggtcggc
cgggtggtgtcacgcgtcgacgtgtccgcgttgtcggtgctcaagacgttcgatccgccg
gtcgcggcgctgcacggcagcaccgtcacggcggcccatcgctggggcaagtacctcggt
atggaagtcgaatccggcggcgcgccgctgcacctcatcacgcacctgtcacgcgcgggg
tggctgcggtggtcggacaaactcgcacccacgccgctcaagccggggaaggggccgatc
gccctgcgcgtgcatttgggggactcccagggcttcgacctcaccgaggcgggcacgcag
aagcggctcgcggtgtgggtggtccgcgatccgatggacgtcccgcagatcgcgagtctc
ggtcccgacgcgctgtcgctggattcgacggccctggccggggtgctcgcgggcaactcc
gggcgcatcaagaccgtgatcaccgaccagaaggtgatggcgggcatcggcaacgcctac
agtgacgagatcctgcacgtggccaagctgtcgccgttcacgaccgcgggcaagctcacc
gatgcgcaactcggtgcgctgcacgacgccatgatcacggtgctcaccgatgccgtgagc
cgctcggtggggcagcaggccgcgacgttgaagggcgagaaacgctcgggcctacgggtc
cacgcgcgcaccggcctgccgtgcccggtgtgcggcgacaccgtgcgggaggtctcgttc
gccgacaagtccttccagtactgcccgacctgccagaccggcggtaaggtgctggccgac
cggcggatgtcgcgcctgctcaaatag

DBGET integrated database retrieval system