KEGG   Mycobacterium smegmatis MC2 155: MSMEG_5837Help
Entry
MSMEG_5837        CDS       T00434                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MSMEG_5837
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MSMEG_5837
Enzymes [BR:msm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MSMEG_5837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(5903317..5903802)
Genome map
AA seq 161 aa AA seqDB search
MSLKNINLTTLDGKQTTLGELAPGAALVVNVASKCGLTPQYSALEKLAQEYGDRGLTVIG
VPCNQFMGQEPGTAEEIQTFCSTTYGVTFPLLAKTDVNGAERHPLYAALTETPDAGGEAG
DIQWNFEKFLLAADGTVVNRFRPRTEPDAPEVIEAIEKVVS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctcaagaacatcaacttgaccaccctcgacggcaagcagaccacgctcggcgag
ttggcccctggggccgcactcgtcgtcaacgtcgcctcgaaatgcggtctgacaccgcaa
tacagcgcactggagaaactcgcgcaggaatacggtgaccgcggcctcacggtgatcggt
gtgccctgtaaccaattcatgggacaggaaccgggcacggccgaggaaattcagacgttc
tgttcgaccacctacggcgtgacgttcccgttgctggccaagaccgacgtcaacggcgca
gagcgccacccgctgtacgccgcactgaccgagacccccgacgccggtggcgaggcgggc
gacatccagtggaacttcgagaagttcctgctggccgccgatggcaccgtcgtcaaccgg
ttccggccccgcacagaaccggacgcccctgaggtgatcgaggcgatcgagaaggtcgtt
tcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system