KEGG   Mycobacterium smegmatis MC2 155: MSMEG_5939Help
Entry
MSMEG_5939        CDS       T00434                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:msm00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:msm00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:msm00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:msm00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:msm00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(5998199..5999164)
Genome map
AA seq 321 aa AA seqDB search
MMSSTKTFEQLGETMPKKSSVAIVGSGNISTDLLYKLLRSEWLEPRWMIGIDPESEGLAR
ARKLGLETSAEGVDWLLAQSEKPDLVFEATSAYVHRDAAPRYEEAGIRAIDLTPAAVGPG
VVPPANLRDHLDAPNVNMVTCGGQATIPIVHAVSRVVDVPYAEIVASVSSASAGPGTRAN
IDEFTKTTSAGVQNIGGAQRGKAIIVLNPAEPPMIMRDTIFCAIPEGADHDAITQSIKDV
VAEVQTYVPGYRLLNEPQFDEPSVVNGGNHLVTTFVEVEGAGDYLPPYAGNLDIMTAAAT
KVGEEIAKKSAEASLASGAQA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgatgtcctcgaccaagactttcgaacagctgggagaaacaatgccgaaaaagtcctcc
gtcgcgatcgtcggatccggcaacatcagcaccgatctgctctacaagctgctccgctcg
gaatggcttgagccacgctggatgatcggcatcgatccggaatccgaaggtttggcgcgg
gcacgcaaactcggcctggagacatccgccgagggagtggactggctgctggcacagagc
gaaaagcctgatctggtcttcgaggccaccagtgcctacgtgcaccgtgacgccgcaccg
cgctacgaggaagcgggcattcgtgccatcgacctcacgcctgccgcggtgggtcctggt
gtcgtcccgccggccaacctgcgcgaccacctcgacgccccgaacgtcaacatggtcacg
tgcggcggtcaggcgaccatcccgatcgtgcatgccgtaagccgcgtggtcgacgtgccc
tacgccgagatcgtcgcgtcggtgtcgtcggcgtcggcaggcccgggcacgcgcgccaac
atcgacgagttcaccaagaccacgagcgccggcgtgcagaacatcggcggtgcgcagcgg
ggcaaggcgatcatcgtcctcaacccggccgaaccgccgatgatcatgcgcgacaccatc
ttctgcgccatccccgaaggcgccgaccacgacgccatcacgcagtccatcaaggacgtc
gtcgccgaggtgcagacgtacgtcccgggctaccgcctgctcaacgaaccgcagttcgac
gagccttcggtggtcaacggcggcaaccatctggtcaccacgttcgtggaagtggagggt
gcgggtgactacctgccgccctacgctggaaatctggacatcatgaccgccgcggcgacg
aaagtcggcgaggaaatcgccaagaaatcggccgaagcaagcctcgcgtcaggagcacag
gcatga

DBGET integrated database retrieval system