KEGG   Mycobacterium smegmatis MC2 155: MSMEG_5939Help
Entry
MSMEG_5939        CDS       T00434                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MSMEG_5939
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MSMEG_5939
   00650 Butanoate metabolism
    MSMEG_5939
  Amino acid metabolism
   00360 Phenylalanine metabolism
    MSMEG_5939
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MSMEG_5939
   00622 Xylene degradation
    MSMEG_5939
   00621 Dioxin degradation
    MSMEG_5939
Enzymes [BR:msm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MSMEG_5939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5998199..5999164)
Genome map
AA seq 321 aa AA seqDB search
MMSSTKTFEQLGETMPKKSSVAIVGSGNISTDLLYKLLRSEWLEPRWMIGIDPESEGLAR
ARKLGLETSAEGVDWLLAQSEKPDLVFEATSAYVHRDAAPRYEEAGIRAIDLTPAAVGPG
VVPPANLRDHLDAPNVNMVTCGGQATIPIVHAVSRVVDVPYAEIVASVSSASAGPGTRAN
IDEFTKTTSAGVQNIGGAQRGKAIIVLNPAEPPMIMRDTIFCAIPEGADHDAITQSIKDV
VAEVQTYVPGYRLLNEPQFDEPSVVNGGNHLVTTFVEVEGAGDYLPPYAGNLDIMTAAAT
KVGEEIAKKSAEASLASGAQA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgatgtcctcgaccaagactttcgaacagctgggagaaacaatgccgaaaaagtcctcc
gtcgcgatcgtcggatccggcaacatcagcaccgatctgctctacaagctgctccgctcg
gaatggcttgagccacgctggatgatcggcatcgatccggaatccgaaggtttggcgcgg
gcacgcaaactcggcctggagacatccgccgagggagtggactggctgctggcacagagc
gaaaagcctgatctggtcttcgaggccaccagtgcctacgtgcaccgtgacgccgcaccg
cgctacgaggaagcgggcattcgtgccatcgacctcacgcctgccgcggtgggtcctggt
gtcgtcccgccggccaacctgcgcgaccacctcgacgccccgaacgtcaacatggtcacg
tgcggcggtcaggcgaccatcccgatcgtgcatgccgtaagccgcgtggtcgacgtgccc
tacgccgagatcgtcgcgtcggtgtcgtcggcgtcggcaggcccgggcacgcgcgccaac
atcgacgagttcaccaagaccacgagcgccggcgtgcagaacatcggcggtgcgcagcgg
ggcaaggcgatcatcgtcctcaacccggccgaaccgccgatgatcatgcgcgacaccatc
ttctgcgccatccccgaaggcgccgaccacgacgccatcacgcagtccatcaaggacgtc
gtcgccgaggtgcagacgtacgtcccgggctaccgcctgctcaacgaaccgcagttcgac
gagccttcggtggtcaacggcggcaaccatctggtcaccacgttcgtggaagtggagggt
gcgggtgactacctgccgccctacgctggaaatctggacatcatgaccgccgcggcgacg
aaagtcggcgaggaaatcgccaagaaatcggccgaagcaagcctcgcgtcaggagcacag
gcatga

DBGET integrated database retrieval system