KEGG   Mycobacterium smegmatis MC2 155: MSMEG_6103Help
Entry
MSMEG_6103        CDS       T00434                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MSMEG_6103 (folP)
Enzymes [BR:msm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MSMEG_6103 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(6164962..6165819)
Genome map
AA seq 285 aa AA seqDB search
MNPPSLTAQPGTPVQVMGVVNVTQDSFSDGGKFIDTDRAVEHGLALVAAGAQIIDVGGES
TRPGATRIDPGVEAARVTPVIRELAAQGITISIDTMHADVARAALEAGAHIVNDVSGGRA
DPGMAGVLAEAKVPWILMHWRSVDADHPHRVPGYRDVVAEVRTELLAAVDAAVTAGVEPE
RLVIDPGLGFAKTAEHNWALLHALPDLVATGVPVLVGASRKRFLGTLLAAADGTPRPPDG
RETATAVISVLAAMHGAWGVRVHDVQASVDALKVLGAWTSGGQIG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgaacccaccgagcctgacggcccagcccggcacacccgtgcaggtgatgggcgtcgtg
aacgtcacgcaagactcgttctccgacggtgggaaattcatcgacaccgaccgcgccgtc
gagcacgggctggccctggtggccgcgggcgcacagatcatcgacgtcggcggtgagtcc
acgcggcccggcgcgacccgcatcgatcccggggtcgaggccgcccgcgtcacgccggtg
atcagagagcttgcggcccaaggcatcacgatcagcatcgacaccatgcacgccgacgtc
gcgcgcgcggcgctcgaagcgggcgcgcacatcgtcaacgacgtgtcgggcgggcgggcc
gatcccggtatggccggcgtgctcgccgaggcgaaggtgccgtggatcctcatgcactgg
cgttcggtcgacgccgaccacccgcaccgcgttccgggataccgcgacgtggtcgccgag
gtgcgcaccgaactgctcgcggcggtcgacgccgcggtgaccgcgggcgtcgaaccggag
cggctcgtcatcgatcccggcctgggtttcgccaagaccgccgagcacaactgggcgctg
ctgcatgcgctgccggacctggtggccacgggcgtcccggtgctggttggcgcgtcgcgc
aaacgtttcctcggtacgctgctggccgccgcggacggcacaccgcgcccaccggacggc
cgtgagaccgcgaccgcggtgatctcggtgctggccgcgatgcacggtgcctggggcgtg
cgggtgcacgacgtacaggcctcggtcgacgcattgaaggtgctgggcgcctggacttct
ggaggacagattggctga

DBGET integrated database retrieval system