KEGG   Mycobacterium smegmatis MC2 155: MSMEG_6229Help
Entry
MSMEG_6229        CDS       T00434                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:msm00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(6292243..6293760)
Genome map
AA seq 505 aa AA seqDB search
MADFVAAIDQGTTSTRCMIFDHDGAEVGRHQLEHEQILPRAGWVEHNPVEIWERTASVVM
TALNRTNLQASDLAALGITNQRETSLVWNRHTGRPYYNAIVWQDTRTDSIAAALDRDGRG
DVIRRKAGLPPATYFSGGKIQWILDNVPGVREDAEKGDAIFGTADSWLVWNLTGGTRGGV
HVTDVTNASRTMLMNLETLDWDDELLSFFGIPRRMLPEIKPSSYPESYGITRDDGPLAGQ
VPLTGILGDQQAAMVGQVCLEAGEAKNTYGTGNFLLLNTGEKIVRSDNGLLTTVCYQFGD
SKPVYALEGSIAVTGSAVQWLRDQLGIISGASQSESLARQVSDNGGVYFVPAFSGLFAPY
WRSDARGAIVGLSRFNTNAHLARATLESICYQSRDVVDAMEADSGVHLEVLKVDGGITAN
ALCMQIQADVLGVDVVKPLVAETTALGAAYAAGLAVGFWENADDLRANWQEDKRWSPQWS
DEQREKGYAGWQKAVQRTLDWVEIE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtggccgatttcgtcgcagcgatcgaccagggcaccacgagcacgcggtgcatgatcttc
gaccatgacggcgccgaagtgggccgccaccagctcgaacacgagcagatcctgcccagg
gcgggctgggtcgagcacaacccggtggagatctgggagcgcaccgcatcggtggtgatg
accgcactcaaccggacgaatctgcaggcctccgacctggccgcgctgggcatcaccaac
cagcgcgagacgtcgctggtgtggaaccggcacaccggcaggccctactacaacgcgatc
gtgtggcaggacacccgcaccgacagcatcgccgcggcactcgaccgtgacggccgcggt
gacgtcatccggcgcaaggccggtctgccgcccgcgacgtacttctcgggcggcaagatc
cagtggatcctggacaacgtgccgggggtccgcgaggacgccgagaagggcgacgcgatc
ttcgggaccgccgacagttggctggtgtggaacctcaccggcggtacgcgcggcggcgtg
cacgtcaccgacgtcaccaacgccagccgcaccatgctgatgaacctggagaccctcgac
tgggacgacgaactgttgtcgttcttcgggattccgcgccggatgctgcccgagatcaag
ccgtcgtcgtatccggagtcgtacggcatcacgcgcgacgacggtccgctggccgggcag
gtgccgttgaccggcatcctcggtgaccagcaggccgcgatggtcggccaggtgtgcctg
gaggccggcgaggccaagaacacctatggcaccggcaatttcctgctgctcaacaccggt
gagaagatcgtgcgctcggacaacggtctgctgaccacggtgtgctaccagttcggcgac
tcgaaaccggtttacgcgcttgagggttcgatcgcggtgaccggatcggccgtgcagtgg
ttgcgcgaccagttgggcatcatcagcggtgcgtcgcagagcgagtcgctggcgcggcag
gtcagcgacaacggcggcgtgtacttcgtgcccgccttctccggcctgttcgcgccgtac
tggcgcagcgacgcgcgcggcgcgatcgtgggcctgtcgcggttcaacaccaacgcgcac
ctggcgcgtgcgacgctggagtcgatctgctaccagagccgcgacgtggtcgacgccatg
gaggcggattccggtgtgcaccttgaggttctcaaggtcgacggtgggatcaccgccaac
gcgctgtgcatgcagatccaggcggacgtgctcggcgtcgacgtggtcaagcccctggtc
gccgagaccaccgcgctcggtgcggcgtacgcggccggtctggcggtgggcttctgggag
aacgccgacgacttgcgggccaactggcaggaggacaagcgctggtcaccgcagtggtca
gatgagcaacgcgagaagggatacgcgggctggcagaaggccgttcagcgcaccctcgac
tgggtcgagatcgagtga

DBGET integrated database retrieval system