KEGG   Mycobacterium smegmatis MC2 155: MSMEG_6242Help
Entry
MSMEG_6242        CDS       T00434                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K17067  
methanol:N,N-dimethyl-4-nitrosoaniline oxidoreductase [EC:1.2.99.4]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:msm01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:msm00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:msm00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(6307532..6308803)
Genome map
AA seq 423 aa AA seqDB search
MAIELNQIWDFPIKEFHPFPRALLGVGAHDIIGVEAKNLGFKRTLLMTTGLRGSGIIEEL
TGKIEYQGVEVVLYDKVESNPKDYNVMEAAALYQQEKCDSIISVGGGSSHDAAKGARVVI
AHDGRNINEFEGFAKSTNKQNPPHIAVSTTAGTGSETSWAYVITDTSDMDHPHKWVGFDE
ATIVTLAIDDPLLYYSCPQHFTAYCGFDVLAHGSEPFVSRLDFAPSLGNALYSVELVAKH
LREAVFEPRNLKAREGMMNAQYIAGQAFNSGGLGIVHSISHAVSAFFDSHHGLNNAIALP
RVWEYNLPARYERYAQLATAMGVDTRNMTTVQAADAAVEAAIRLAQDVGIPDNFSQVRVD
SYAKNQMNTGKYAGKGEVIKGDDKTIRAISEHIQDDWCTPGNPREVTVESMIPVVNHAIN
ESY
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggccattgagctgaaccagatttgggatttcccgatcaaggagttccacccgttcccc
cgcgcgctgctgggcgtcggggcacacgacatcatcggcgtcgaggccaagaacctcggc
ttcaagcgcaccctgctgatgaccacgggcctgcgcggctcgggcatcatcgaggaactc
accggcaagatcgagtaccagggcgtcgaggtggtcctctacgacaaggtggagtcgaac
cccaaggactacaacgtcatggaggccgcggcgctctaccagcaggagaagtgcgacagc
atcatctccgtcggtggcgggtcgagccacgacgccgccaagggtgcgcgcgtggtcatc
gcccacgacggccgcaacatcaacgagttcgagggcttcgccaagtccaccaacaagcag
aacccgccgcacatcgcggtatccaccacggccggaacgggttcggagacatcgtgggcc
tacgtcatcaccgacacctccgacatggaccacccgcacaagtgggtgggcttcgacgag
gcgaccatcgtcaccctcgcgatcgacgatccgctgctgtactacagctgcccgcagcac
ttcaccgcctactgcggcttcgatgtgctcgcgcacggcagtgagccgttcgtgtcgcgg
ctggacttcgcgccgtcgctcggaaatgccctgtactccgtcgaactcgtcgccaagcat
ctgcgcgaggcggtgttcgaaccgcgcaacctcaaggcccgcgaaggcatgatgaacgcg
cagtacatcgccgggcaggcgttcaactcgggcggcctgggcatcgtgcactccatcagc
catgcggtcagcgcgttcttcgacagccaccacggcctcaacaacgccatcgccctgccg
cgggtatgggagtacaacctgcccgcgcgctacgagcgctacgcacagctcgcgacggcg
atgggtgtggacacccgcaacatgaccacggtgcaggcggccgacgccgcagtcgaggcc
gcgattcggctggcgcaggacgtcggcatcccggacaacttctcgcaggtccgcgtcgac
tcgtacgccaagaaccagatgaacaccggcaagtacgccggcaagggcgaggtgatcaag
ggcgacgacaagaccatccgcgcgatctccgagcacatccaggacgactggtgcacgccg
ggcaacccgcgtgaggtgaccgttgagtcgatgatccccgtggtgaaccacgcgatcaac
gagtcctactga

DBGET integrated database retrieval system