KEGG   Mycobacterium smegmatis MC2 155: MSMEG_6242Help
Entry
MSMEG_6242        CDS       T00434                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K17067  
methanol:N,N-dimethyl-4-nitrosoaniline oxidoreductase [EC:1.2.99.4]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSMEG_6242
  Energy metabolism
   00680 Methane metabolism
    MSMEG_6242
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MSMEG_6242
Enzymes [BR:msm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.99  With other acceptors
    1.2.99.4  formaldehyde dismutase
     MSMEG_6242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(6307532..6308803)
Genome map
AA seq 423 aa AA seqDB search
MAIELNQIWDFPIKEFHPFPRALLGVGAHDIIGVEAKNLGFKRTLLMTTGLRGSGIIEEL
TGKIEYQGVEVVLYDKVESNPKDYNVMEAAALYQQEKCDSIISVGGGSSHDAAKGARVVI
AHDGRNINEFEGFAKSTNKQNPPHIAVSTTAGTGSETSWAYVITDTSDMDHPHKWVGFDE
ATIVTLAIDDPLLYYSCPQHFTAYCGFDVLAHGSEPFVSRLDFAPSLGNALYSVELVAKH
LREAVFEPRNLKAREGMMNAQYIAGQAFNSGGLGIVHSISHAVSAFFDSHHGLNNAIALP
RVWEYNLPARYERYAQLATAMGVDTRNMTTVQAADAAVEAAIRLAQDVGIPDNFSQVRVD
SYAKNQMNTGKYAGKGEVIKGDDKTIRAISEHIQDDWCTPGNPREVTVESMIPVVNHAIN
ESY
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggccattgagctgaaccagatttgggatttcccgatcaaggagttccacccgttcccc
cgcgcgctgctgggcgtcggggcacacgacatcatcggcgtcgaggccaagaacctcggc
ttcaagcgcaccctgctgatgaccacgggcctgcgcggctcgggcatcatcgaggaactc
accggcaagatcgagtaccagggcgtcgaggtggtcctctacgacaaggtggagtcgaac
cccaaggactacaacgtcatggaggccgcggcgctctaccagcaggagaagtgcgacagc
atcatctccgtcggtggcgggtcgagccacgacgccgccaagggtgcgcgcgtggtcatc
gcccacgacggccgcaacatcaacgagttcgagggcttcgccaagtccaccaacaagcag
aacccgccgcacatcgcggtatccaccacggccggaacgggttcggagacatcgtgggcc
tacgtcatcaccgacacctccgacatggaccacccgcacaagtgggtgggcttcgacgag
gcgaccatcgtcaccctcgcgatcgacgatccgctgctgtactacagctgcccgcagcac
ttcaccgcctactgcggcttcgatgtgctcgcgcacggcagtgagccgttcgtgtcgcgg
ctggacttcgcgccgtcgctcggaaatgccctgtactccgtcgaactcgtcgccaagcat
ctgcgcgaggcggtgttcgaaccgcgcaacctcaaggcccgcgaaggcatgatgaacgcg
cagtacatcgccgggcaggcgttcaactcgggcggcctgggcatcgtgcactccatcagc
catgcggtcagcgcgttcttcgacagccaccacggcctcaacaacgccatcgccctgccg
cgggtatgggagtacaacctgcccgcgcgctacgagcgctacgcacagctcgcgacggcg
atgggtgtggacacccgcaacatgaccacggtgcaggcggccgacgccgcagtcgaggcc
gcgattcggctggcgcaggacgtcggcatcccggacaacttctcgcaggtccgcgtcgac
tcgtacgccaagaaccagatgaacaccggcaagtacgccggcaagggcgaggtgatcaag
ggcgacgacaagaccatccgcgcgatctccgagcacatccaggacgactggtgcacgccg
ggcaacccgcgtgaggtgaccgttgagtcgatgatccccgtggtgaaccacgcgatcaac
gagtcctactga

DBGET integrated database retrieval system