KEGG   Mycobacterium smegmatis MC2 155: MSMEG_6279Help
Entry
MSMEG_6279        CDS       T00434                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:msm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(6344309..6344920)
Genome map
AA seq 203 aa AA seqDB search
MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPPDIDRLTAVLGRIRDGVTFCSVCG
NVSDEERCRICSDPRRDASLVCVVEEPKDVQAVERTREFRGRYHVLGGALDPLSGIGPEQ
LRIRELLNRIGERVEGVDVAEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPM
GGDLEFADELTLGRALAGRRAMV
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagggcccggtccaggatctgatcgacgagctgggcaagcttcccggtatcggc
cccaagagtgcccagcggatcgccttccacctgctgtcggtcgaaccgcccgacatcgac
cggctgaccgcggtgctcggacgcatccgtgacggggtcacgttctgctcggtgtgcggc
aacgtctccgacgaggaacgctgccggatctgcagcgacccgcgccgcgacgcgtcgctg
gtatgcgtcgtcgaggaacccaaggatgtgcaggcagtagaacgcacccgcgagttccgc
gggcgctaccacgtgctcggtggcgcgctcgacccgctgagcggcatcggccctgagcag
ctgcgcatccgggaactgctcaaccgcatcggcgaacgcgtcgagggcgtcgacgtcgcc
gaggtcatcatcgcgaccgatcccaacaccgagggcgaggccaccgcgacctatctggtg
cgcatgctccgcgacatccccggcctgacggtcacccgcatcgcgtcgggcctgccgatg
ggtggggatctcgagttcgccgacgagctcaccctgggccgcgcgctggccggccgccgc
gcgatggtctag

DBGET integrated database retrieval system