KEGG   Mycobacterium smegmatis MC2 155: MSMEG_6506Help
Entry
MSMEG_6506        CDS       T00434                                 

Definition
nicotinamidase/pyrazinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MSMEG_6506
Enzymes [BR:msm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     MSMEG_6506
    3.5.1.-  
     MSMEG_6506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6567028..6567579
Genome map
AA seq 183 aa AA seqDB search
MRALIVVDVQNDFCEGGSLAVTGGAAVARGITELLAGDHGYDHVVATMDFHIDPGEHFSD
TPDYQVSWPRHCVADTPGAEFHPEFDAGAVEVVFRKGHYSAAYSGFEGTDESGTTLADWL
RERDVDAVDVVGIATDYCVAATAADAAGAGFATRVLTRLTAGVAPESTTAAVDQLRSAGV
TIS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcactgattgtcgtcgacgtccagaacgatttctgcgagggcggttcgctggcg
gtcaccggtggtgcggcagtggcccgcgggatcaccgaactgctggccggtgatcatggt
tacgaccatgtggtcgccacaatggatttccacatcgacccgggtgagcacttctcggac
acacccgactaccaggtgtcgtggccgcgccactgcgtggccgacaccccgggcgccgag
ttccatccggagttcgatgcaggtgcggtggaggtggtgttccgcaagggccactactcg
gcggcctacagcggcttcgagggcaccgacgaatcggggacgacgctggccgactggctg
cgcgagcgggatgtcgacgcggtcgacgtcgtcggcatcgccaccgactactgcgtggcc
gccacggccgccgacgccgcgggcgccggtttcgccacccgcgtgctcacgcggctgacg
gccggggtcgcgcccgagagcacgacggcggcggtcgaccaattgcgttctgccggagtg
acgatcagctga

DBGET integrated database retrieval system