KEGG   Mycobacterium smegmatis MC2 155: MSMEG_6506Help
Entry
MSMEG_6506        CDS       T00434                                 

Definition
nicotinamidase/pyrazinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:msm00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
6567028..6567579
Genome map
AA seq 183 aa AA seqDB search
MRALIVVDVQNDFCEGGSLAVTGGAAVARGITELLAGDHGYDHVVATMDFHIDPGEHFSD
TPDYQVSWPRHCVADTPGAEFHPEFDAGAVEVVFRKGHYSAAYSGFEGTDESGTTLADWL
RERDVDAVDVVGIATDYCVAATAADAAGAGFATRVLTRLTAGVAPESTTAAVDQLRSAGV
TIS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcactgattgtcgtcgacgtccagaacgatttctgcgagggcggttcgctggcg
gtcaccggtggtgcggcagtggcccgcgggatcaccgaactgctggccggtgatcatggt
tacgaccatgtggtcgccacaatggatttccacatcgacccgggtgagcacttctcggac
acacccgactaccaggtgtcgtggccgcgccactgcgtggccgacaccccgggcgccgag
ttccatccggagttcgatgcaggtgcggtggaggtggtgttccgcaagggccactactcg
gcggcctacagcggcttcgagggcaccgacgaatcggggacgacgctggccgactggctg
cgcgagcgggatgtcgacgcggtcgacgtcgtcggcatcgccaccgactactgcgtggcc
gccacggccgccgacgccgcgggcgccggtttcgccacccgcgtgctcacgcggctgacg
gccggggtcgcgcccgagagcacgacggcggcggtcgaccaattgcgttctgccggagtg
acgatcagctga

DBGET integrated database retrieval system