KEGG   Mycobacterium smegmatis MC2 155: MSMEG_6563Help
Entry
MSMEG_6563        CDS       T00434                                 

Definition
dihydrokaempferol 4-reductase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
msm  Mycobacterium smegmatis MC2 155
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(6618733..6619743)
Genome map
AA seq 336 aa AA seqDB search
MTATKLVIGASGFLGSHVTRRLVERGEDVRILIRSTSSTRGIDDVIDRVDVRHGDIFDAA
SVRDAADGCDTVYYCVVDARAWLRDATPLWRTNVDGLSGVLDVMTEPEIASGVRRFVFTS
SIATIGLPESGPATEEIENNWLDRGGEYVRSRVRAEQLVLRYHKDRGLPAVAMCVSNTYG
PGDWQPTPHGGLVAAAVRGKMPFYIDGAEAEAVGVADAAEALVLAGERGTPGERYIVSER
MMSAREIYEVACDAVGVEPPRRGVPIRVMAAAAGLSSAVARLRRRETRLSPLTVRLMHVM
SPMDHGKAVRELGWKPAPAPESIAQAARFFASRRRT
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgacgaaactggtgatcggggccagcggatttctcggctcgcacgtcaccagg
cgtctggtggaacgcggcgaggacgtacgcattctcatccggtcgacgagttcgacgcgc
ggcatcgacgacgtgatcgaccgtgtggacgtccgtcacggcgacatcttcgacgccgcg
tccgtgcgcgatgccgccgacgggtgcgacacggtgtactactgcgtggtcgatgcacgt
gcctggctgcgcgacgcgacgccgctgtggcgcacgaacgtcgacggcctgagcggtgtc
ctggacgtcatgaccgaacccgaaattgcctcaggggtacgccggttcgtgttcaccagc
tcgatcgcgaccatcgggcttcctgaaagtggaccggccacagaggaaatcgagaacaac
tggctggaccgtggcggagagtacgtgcgcagccgcgtacgcgccgagcagttggtgctc
cggtaccacaaggaccgtgggctgcccgcggtcgcgatgtgtgtctccaacacctacggg
ccaggtgactggcagccgacgccgcacggtgggctcgtcgcggccgcggtacgcggcaag
atgccgttctacatcgacggcgccgaggccgaggcggtcggtgtggcagacgccgccgag
gccctggtccttgccggtgagcgcggcacgcccggtgagcgctacatcgtctcggaacgc
atgatgtccgctcgcgagatctacgaggtcgcctgcgatgcagtcggtgtcgagccgccg
cgtcgtggtgtgccgatccgtgtgatggccgcggcagcgggcctgtcctcggccgtcgca
cgcctgcgcaggcgcgagaccaggttgagcccgctgaccgtgcgactcatgcacgtcatg
tcgccgatggaccacggcaaggctgtgcgcgaactcggctggaaacccgccccggcacca
gagtccatcgcgcaggccgcgcgcttcttcgcgtcgaggaggcgtacatga

DBGET integrated database retrieval system