KEGG   Mycobacterium smegmatis MC2 155: MSMEG_6752Help
Entry
MSMEG_6752        CDS       T00434                                 

Definition
endoglucanase A (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MSMEG_6752
Enzymes [BR:msm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MSMEG_6752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(6796297..6797238)
Genome map
AA seq 313 aa AA seqDB search
MAVTALAGAGALAEPVRPGAAIEVRLASDGNPLAGQTFYVDPNSKAMRALKGNPSPELEM
IANTPHAYWMDNVSTFAVDAKYIQTAQAAGTMPILALYGIPNRDCGSLAAGGFGSAAAYR
GWIDGVAGAIGSGPAAVILEPDALAMADCLSPDQRQERFDLIRYAVDTLTRNPATAVYVD
AGHSRWVNAEDMAARLNEVGVTKTRGFSLNTANFFTTEEEIGYGEAISGLTNGSHYVIDT
SRNGVGPVDSDSWCNPPGRALGSPPTTATAGAHADAYLWVKRPGESDGACNGHPSAGTFV
SQYAIDLARNAGR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
ttggccgtgacggccctggccggcgccggtgcgctcgccgaaccggtgcgcccgggtgcc
gcgatcgaggtacgcctcgccagcgacgggaacccgctcgccgggcagacgttctatgtc
gacccgaactccaaggcgatgcgcgcgctgaagggcaatcccagccccgagctggagatg
atcgcgaacacgccgcacgcgtactggatggacaacgtgtcgacgttcgcggtcgacgcc
aagtacatccagacggcgcaggccgcgggcaccatgccgatcctggcgttgtacggcatc
ccgaaccgtgactgcggcagcctcgcggcgggcggcttcggctcggcggcggcctaccgg
ggatggatcgacggcgtcgccggtgcgatcggctcgggtccggccgcggtgatcctcgaa
cccgacgcgctcgcgatggccgactgcctgtcgcccgaccagcgccaggaacgtttcgac
ctgatccgctacgcggtcgacacgctgacccgcaaccccgccaccgcggtgtacgtcgac
gccgggcactcgcgctgggtcaacgccgaggacatggccgcccggctcaacgaggtcggc
gtcaccaaaacgcgcggattcagcctcaacaccgccaacttcttcaccaccgaggaagag
atcggctacggcgaggccatctccgggctcaccaacggttcgcactacgtcatcgacacg
tcgcgcaacggcgtcggacccgtcgacagcgactcgtggtgcaacccgcccggacgtgcg
ctggggtcgcctccgaccaccgcgaccgcgggcgcccacgccgatgcctacctgtgggtg
aagaggcccggcgaatccgacggtgcctgcaacgggcatccctcggcgggcacgttcgtc
agccagtacgcgatcgacctcgcacgcaacgccggacgctga

DBGET integrated database retrieval system