KEGG   Mycobacterium smegmatis MC2 155: MSMEG_6785Help
Entry
MSMEG_6785        CDS       T00434                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K20905  
L-erythrulose 4-phosphate epimerase [EC:5.1.3.39]
Organism
msm  Mycobacterium smegmatis MC2 155
Brite
Enzymes [BR:msm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.39  L-erythrulose 4-phosphate epimerase
     MSMEG_6785 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(6833969..6834760)
Genome map
AA seq 263 aa AA seqDB search
MPDARALGAAQLWIGTSWKMNKGLAESRGYARELAEYVAAKPPAGVQPFIIPSFTALTTV
RDALGDDSPVLLGVQNAHWEDHGAWTGEVSVAQAKDAGAQIVEIGHSERREHFGETVETT
RLKVAAALHHGLVPLLCIGESAENKQAGESSRFILEQAAGALEGLTDEHLARVLIAYEPI
WAIGENGRPATVEELRQPFDDLAREYGCRTMGLLYGGSVNTDNAEDLLGIDHVTGLFIGR
AAWQLPGYVRILEMAAAHPKAKA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgacgctcgggcgctcggcgccgcacagctgtggatcggcaccagctggaagatg
aacaaggggctcgccgagtcgcgtggttacgcccgcgaactggccgagtacgtcgcggcg
aagccgccggccggcgtccagccgttcatcatcccgtcgttcaccgcactcaccacggtg
cgggacgcgctgggcgacgactcgcccgtgctgctcggggtgcagaacgcacactgggag
gaccacggcgcatggaccggtgaggtctccgtcgcgcaggcgaaggacgcaggcgcgcag
atcgtcgagatcgggcactccgagcgtcgtgagcatttcggtgagaccgtcgagaccaca
cggctcaaggtggccgcggcgctgcatcacggtctggtgccgctgctgtgcatcggcgag
agcgccgagaacaagcaggccggtgagtcgtcgcgcttcatcctcgagcaggccgcaggc
gccctggagggtttgaccgacgagcatttggcccgcgttctcattgcctacgagcccatc
tgggcgatcggcgagaacggtcgcccggcgaccgtcgaggaactgcggcagccgttcgat
gatctggcacgcgaatacggttgtcgcacaatgggattgctctacggtgggtcggtgaac
accgacaacgccgaagatctgctgggcatcgatcacgtcacggggttgttcatcggacgg
gcggcctggcagttgcccggttacgtgcggatccttgagatggccgcggctcaccccaag
gccaaggcctga

DBGET integrated database retrieval system