KEGG   Mycobacterium smegmatis MC2 155: MSMEG_6833Help
Entry
MSMEG_6833        CDS       T00434                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Organism
msm  Mycobacterium smegmatis MC2 155
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
6883673..6884752
Genome map
AA seq 359 aa AA seqDB search
MGRLMVITPIPHPWLIWCRDLMSSYRAYQVTGRRKFELVQREIRDPAEEQVRIRTLACGV
CHSDALAVEGQRPNPEEPVVPGHEVVGVVDAVGSGIQERWRIGERVGVGFLGGQCGHCDY
CRRGDFVNCLDQPLTGTTVDGGYSEMLYVRESALVRVPEGFDALTAAPLLCAGVTVFNAL
RAGDAPPNTLVAVQGLGGLGHLGVQYAKKLGYEVAAIARGTDKADLAATLGADHYIDSAT
EDVAAGLTRLGGAAAVVATASSGQSMAGLVAGLRPRGRLVVVGAAPDPIPVQTPDLIFGG
RTIVGSLTGSAIDNEDNLAFSLNHQIAPMIERMPFTEAPQAYERMMSGHARFRVVLDFS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgggccgactgatggtcatcacgcctataccgcatccatggctgatctggtgtcgtgac
ctcatgagttcataccgtgcgtaccaggtcactggtcgacgcaaattcgaactggtgcag
cgcgagatacgagaccccgccgaagagcaggtgcgcatacgcacgctggcgtgcggggta
tgtcatagcgacgcactcgccgtcgaggggcagcggccgaatccagaggagcctgtcgtt
cccggtcacgaggtggtcggtgtggtcgacgcagtcggcagcgggatccaggagcgttgg
cgaatcggcgaacgtgtgggcgtgggtttcctcggcggtcagtgcggtcactgcgactac
tgccgccggggcgacttcgtgaactgcctcgaccagcccctgaccgggacgacggtcgac
ggtgggtactcggagatgctgtatgtgcgggaatccgcgttggtccgtgttcctgaggga
ttcgacgcgctcaccgccgcaccgttgttgtgcgccggtgtcacggtgttcaacgcgttg
cgcgcaggcgacgcaccgcccaacaccctggttgccgtgcagggcctcggcggactgggg
cacctcggcgttcagtacgcgaagaaattgggctatgaggttgccgcgatagcccgcggc
accgacaaggccgatctggccgccaccttgggggccgaccactacatcgacagtgccacc
gaggacgtcgccgcgggactcacccgattgggtggggcggccgccgtcgtcgcgacggcc
agcagcggccaatcgatggccggcttggtggcagggctcaggccacgcgggcgcttggtt
gtcgtcggagccgcccccgacccgataccagtacagaccccggacctgatcttcggcggc
cgcaccatcgtcggcagcctcacaggctcggcaatcgacaatgaagacaacctcgcattc
agcctcaaccaccagatcgcaccgatgatcgagcgcatgccgttcaccgaggcgccccag
gcgtacgaacgaatgatgtccggacacgcgcgttttcgcgtggttctcgatttcagctga

DBGET integrated database retrieval system