KEGG   Mycobacterium smegmatis INHR1: LI99_29710Help
Entry
LI99_29710        CDS       T03409                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
msn  Mycobacterium smegmatis INHR1
Pathway
msn00071  Fatty acid degradation
msn00072  Synthesis and degradation of ketone bodies
msn00280  Valine, leucine and isoleucine degradation
msn00310  Lysine degradation
msn00362  Benzoate degradation
msn00380  Tryptophan metabolism
msn00620  Pyruvate metabolism
msn00630  Glyoxylate and dicarboxylate metabolism
msn00640  Propanoate metabolism
msn00650  Butanoate metabolism
msn00900  Terpenoid backbone biosynthesis
msn01100  Metabolic pathways
msn01110  Biosynthesis of secondary metabolites
msn01120  Microbial metabolism in diverse environments
msn01130  Biosynthesis of antibiotics
msn01200  Carbon metabolism
msn01212  Fatty acid metabolism
msn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:msn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LI99_29710
   00630 Glyoxylate and dicarboxylate metabolism
    LI99_29710
   00640 Propanoate metabolism
    LI99_29710
   00650 Butanoate metabolism
    LI99_29710
  Lipid metabolism
   00071 Fatty acid degradation
    LI99_29710
   00072 Synthesis and degradation of ketone bodies
    LI99_29710
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LI99_29710
   00310 Lysine degradation
    LI99_29710
   00380 Tryptophan metabolism
    LI99_29710
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LI99_29710
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LI99_29710
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LI99_29710
Enzymes [BR:msn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LI99_29710
Exosome [BR:msn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LI99_29710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIU17630
UniProt: A0A0D6J0I6
Position
complement(6072456..6073604)
Genome map
AA seq 382 aa AA seqDB search
MPEAYIIDAVRTPVGKKNGSLAQVHPIDLGVHVFRSIFDRVDVDPGAVDDVIVGCVDAIG
GQAGNIGRNAWLAAGYPEEVPGVTVDRQCGSSQQAISFGAQAIMSGTADIILAGGMQNMS
WVPISSAMIVGKELGFSTPTAESEYWRHRYGDQEISQFRGSELIAERWDISREEMEQFAL
SSHQRAFAAIRAGHFDNEIVPVGDFGVDEGPRETTLEKMAALQPLVEGGRLTAALASQIS
DGASAVLLASEQAVKEHNLKPRARIHHISARGADPVMMLTGPIPATEYALKKTGLSIDDI
DTVEINEAFAPVVLAWIKDLKADPEKVNPNGGAIALGHPLGATGAKLFATMLNTLERTGG
RYGLQTMCEGGGTANVTIIERL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggcgtacatcatcgatgccgtacgcacccccgtcggaaagaagaacgggtcg
ctggctcaagtgcatccgatcgatctcggcgtgcacgtgttccgcagcatcttcgatcgc
gtcgacgtggatccgggtgcggtcgacgacgtcatcgtcggctgtgtcgacgccatcggt
gggcaggcgggcaacatcggccgcaacgcgtggctggccgcgggctaccccgaagaggtc
cccggcgtcaccgtcgaccggcagtgcggctccagccagcaggccatttcctttggtgcg
caggcgatcatgtcgggcaccgcggacatcatcctcgccggtggcatgcagaacatgagc
tgggtgcccatctcgtcggccatgatcgtcggcaaggaactcggattcagcacgcccaca
gccgaatccgagtactggcggcaccgctacggcgatcaggagatctcgcagttccgcggt
tcggaactcatcgccgagcgctgggacatctcccgcgaggagatggagcagttcgcgctg
tccagccatcagcgtgcgttcgcggcaatccgtgccgggcacttcgacaacgagatcgtg
ccggtcggtgacttcggtgtcgacgaggggccgcgcgagaccacgctggagaagatggcc
gcactgcagccgctcgtcgagggtggccgtctcaccgcggcgctcgccagccagatctcc
gacggcgcaagcgcggtgctgctggcctccgagcaggccgtcaaggagcacaacctcaag
ccgcgcgcccgcatccaccacatcagcgcccgcggcgccgatccggtcatgatgctcacg
ggcccgatccccgcgacggagtacgcgctcaagaagaccggcctgtcgatcgacgacatc
gacaccgtcgagatcaacgaggcgttcgcgcccgtcgtcctcgcctggatcaaggacctc
aaggccgatccggagaaggtcaaccccaacggcggcgcgatcgcgctcggtcacccgctc
ggcgcgaccggtgccaagctgttcgccaccatgctcaacaccctcgagcgcaccggcggc
cgctacggcctgcagaccatgtgcgagggtggcggcaccgcgaacgtcaccatcatcgag
cgcctctag

DBGET integrated database retrieval system