KEGG   Mycobacterium gilvum Spyr1: Mspyr1_03390Help
Entry
Mspyr1_03390      CDS       T01376                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Mspyr1_03390
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Mspyr1_03390
Enzymes [BR:msp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Mspyr1_03390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
347540..348760
Genome map
AA seq 406 aa AA seqDB search
MPLLSGRMPAPRSVSHALIGVLAASALLVGCTSAQPEPEQPAPPGPSLVAGTAPVPAAPA
PVVPAAPVCGDPAAAVAAMSTRDKLAQLLMVGVTGAADARTAAAEYHVGGIMVGSWTDLS
MLTDGSLPDIANAGLLPLAVSVDEEGGRVSRLSGLIGPQPSARVLAQTKTPDEVRAIARD
RGAKMRNLGITVDFAPVVDVSDAPDNTVIGDRSFGADPTTVTDYAGAYAQGLREAGVLPV
LKHFPGHGSGSGDSHVGSVVAPSLEQLQASDLVPYRTLAAQAPVGVMVGHVEVPGLTGSD
PASLSPQAYGLLRSGGYGGPPFGGVVFTDDLSGMQAISDRLGVAEAVLRALQAGADVALW
LSTGEVPAVLDRLEKAVGAGELTMSGVDGAVTRIVAMKGPSPRCGG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgccgttactgtcaggacgcatgcccgccccacgaagcgtttctcacgccctgatcgga
gtgctggcggcatcggcgctgctggtgggctgcacgtctgcccagcccgagcccgagcag
ccggcgccccccggcccgtcgctggtcgcagggacggctccggtgccggccgctccggcg
ccggtcgtccccgccgccccggtctgcggtgatccggcggccgccgtggccgcgatgtcg
acccgcgacaagctggcgcagctgctgatggtcggcgtcaccggcgccgccgacgcccgg
actgcggccgccgagtaccacgtcggcggcatcatggtgggcagctggacggacctgtcg
atgctcaccgacggctcgctgcccgacatcgcgaacgcgggcctgctgcccctggcggtc
agcgtcgacgaagagggcggccgggtctcgcggctgtccggcctgatcggcccccagccc
tccgcgcgggttctggcccagacgaagaccccggacgaggttcgcgcgatcgcgcgcgac
cgcggcgcgaagatgcgcaacctcgggatcacggtcgacttcgcgcccgtcgtcgacgtc
tccgacgcccccgacaacaccgtgatcggcgaccgctcgttcggcgcggacccgacgacg
gtgaccgattacgccggcgcctacgcccaggggctgcgcgaggccggggtgttgcccgtc
ctcaagcacttccccggccacggcagcggatcgggcgattcgcatgtcggcagcgtcgtc
gccccgtcgctcgagcagctgcaggcctccgacctggtcccgtaccggacgctggccgcg
caggcgcccgtcggcgtgatggtcgggcacgtcgaggtgccgggtctgaccggcagcgat
cccgccagcctcagcccgcaggcgtacggcctgctgcgttccggcggctacggcggcccg
ccgttcggcggggtggtcttcaccgacgacctgtccgggatgcaggcgatctcggaccgg
ctcggggtggccgaggcggtgctgcgcgcgctgcaggccggtgccgacgtggcgctgtgg
ctgtccaccggcgaggttccggctgtgctggaccgactggagaaggccgtcggtgccggc
gagctgaccatgtcgggagtggacggggcggtcacgcggatcgtcgcgatgaagggtccg
tcacctcggtgcggcggctga

DBGET integrated database retrieval system