KEGG   Mycobacterium gilvum Spyr1: Mspyr1_05400Help
Entry
Mspyr1_05400      CDS       T01376                                 

Definition
Zn-dependent alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mspyr1_05400
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mspyr1_05400
  Lipid metabolism
   00071 Fatty acid degradation
    Mspyr1_05400
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mspyr1_05400
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mspyr1_05400
   00626 Naphthalene degradation
    Mspyr1_05400
Enzymes [BR:msp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mspyr1_05400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
565824..566837
Genome map
AA seq 337 aa AA seqDB search
MPTHKAVHVAGANEDLTLVEVETAPPPPGHVRLAVKACGVCGTDREFRAGHFPGLQWPLT
LGHEIAGTVAEVGDGVEDFSVGDRVAVGWFGGNCNRCIPCRRGSFMQCERMQVPSWHYPG
GYAESVTVPWTALARIPEGLSFVEAAPMGCAGVTTFNGLRQTRAKAGDVVAVLGVGGLGH
LGVQWSRAMGFETVAIARGTGKAEEARELGAHHYIDSTGQDVAAELKKLGGAAVVLATAN
NAEAMAATVGGLGPAGELVVVGVSADNLPISPLHLINDGLSVTGHPSGTSRDVEETLHFA
MLSGVRARVQEVPLAQAAEAYEAMDSSRARYRMVLTV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcccacccacaaggccgtgcatgtcgccggtgccaacgaagatctgactctcgtcgag
gtggagaccgcgccaccaccgcccggccacgtccgcctcgcagtgaaggcctgcggcgtc
tgtggcacagaccgggagttccgcgccggccatttccccggtctgcagtggccgttgacg
ctgggccacgagatcgccggaaccgtcgccgaggtcggtgacggcgtcgaggatttctcg
gtcggcgaccgggtcgccgtcggctggttcggcggcaactgcaaccgctgcatcccgtgc
cggcgcggatcgttcatgcagtgcgagcgcatgcaggtgcccagctggcactatcccggc
gggtacgccgagtcggtgacggtgccgtggacggccctggcgcgcatcccggaaggactg
tcgttcgtcgaggccgcaccgatggggtgcgccggggtcaccacgttcaacggtctgcgg
cagacgcgcgccaaggccggcgacgtggtcgcggtgctcggggtgggtgggctcggccac
ctcggtgtgcagtggtcgcgggccatggggttcgagacggtcgcgatcgcgcgggggacg
ggcaaggccgaggaggccagggagctgggagcccaccactacatcgactcgacggggcag
gatgtcgccgcggagctgaagaagctgggcggcgcggcggtcgtgctggccacggccaac
aacgccgaggcgatggccgccaccgtcggggggttgggtccggccggcgagctggtggtc
gtcggtgtctccgcggacaacctcccgatcagcccgctgcacctgatcaacgacgggctg
tcggtgaccggccacccgtcgggcacctcacgcgacgtcgaggagaccctgcacttcgcg
atgctgtccggggtgcgggccagggtgcaggaagtgccgctggcgcaggccgccgaggcc
tacgaggcgatggactccagccgggcccgctaccggatggtgctgaccgtctga

DBGET integrated database retrieval system