KEGG   Mycobacterium gilvum Spyr1: Mspyr1_07000Help
Entry
Mspyr1_07000      CDS       T01376                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mspyr1_07000
   01230 Biosynthesis of amino acids
    Mspyr1_07000
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mspyr1_07000
  Energy metabolism
   00680 Methane metabolism
    Mspyr1_07000
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mspyr1_07000
Enzymes [BR:msp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mspyr1_07000
Exosome [BR:msp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mspyr1_07000
  Exosomal proteins of melanoma cells
   Mspyr1_07000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
714477..715244
Genome map
AA seq 255 aa AA seqDB search
MADTATADTATLILLRHGESEWNALNLFTGWVDVDLTDKGRAEATRAGELIGEQDKLPDV
LYTSLLRRAITTANIALDKADRHWIPVHRDWRLNERHYGALQGLNKAETKAKYGDEQFMA
WRRSYDTPPPQIEAGSEFSQDRDPRYADIDGGAPLTECLKDVVERFVPYFTEVIVPDLKA
GKTVLIAAHGNSLRALVKYLDGMSDDDVVGLNIPTGIPLRYDLDESLKPLVAGGSYLDPD
AAAAGAAAVAAQGAK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggctgataccgcgacggctgataccgcgacgctgatcctgctccgccacggtgagagc
gaatggaacgccctgaacctgttcaccggctgggtcgacgtcgacctcacggacaagggc
agggccgaggcgacccgggcgggcgagttgatcggcgaacaggacaagcttcccgacgtg
ctgtacacctcgctgctgcggcgcgcgatcacgaccgcgaacatcgcgctcgacaaggcc
gaccggcactggatccccgtgcaccgcgactggcggctcaacgaacgccactacggcgcg
ctgcagggactgaacaaggccgagacgaaggccaagtacggcgacgagcagttcatggcg
tggcgtcgcagctacgacaccccgcccccgcagatcgaggcaggcagcgagttcagccag
gaccgcgacccgcgctacgccgacatcgacggtggcgctccgctgaccgaatgcctcaag
gacgtcgtggaacggttcgtgccgtacttcaccgaggtgatcgttcccgacctgaaagcc
gggaagaccgtgctgatcgccgctcacggcaattcgctgcgcgcgctggtcaagtacctc
gacgggatgtccgacgacgacgtcgtgggcctcaacatcccgacgggcattccgctgcgc
tacgacctggacgagagtctgaagcccctcgtggccggtggcagctacctcgaccccgat
gccgcggccgccggtgcggccgcggtggccgcgcagggagccaagtag

DBGET integrated database retrieval system