KEGG   Mycobacterium gilvum Spyr1: Mspyr1_07230Help
Entry
Mspyr1_07230      CDS       T01376                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mspyr1_07230
Enzymes [BR:msp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mspyr1_07230
Exosome [BR:msp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mspyr1_07230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
735175..736155
Genome map
AA seq 326 aa AA seqDB search
MGFPRHRPRRLRTTPAMRRLVSETSLEPRHLVLPMFVADGLDEPRDIASMPGVVQHTRES
LRRAAAEAVEAGVGGLMLFGVPRDEDKDATGSIGVDPDGILNRALRDLTRDLGDDTVLMA
DTCLDEFTDHGHCGVVDPTGRVDNDLTNRRYVELAVAQANSGAQVVSPSGMMDGQVAAIR
DGLDVAGYTHTAILAYSAKFASGFYGPFREAVGSSLEGDRRTYQQDPGNGREALHEVRLD
IEEGADIVMVKPAMSYLDVVRATAEICPLPLAAYQVSGEYSMIAAAAEKGWIDLPTVVLE
SLVGIRRAGADIVLSYWAVDVARWLT
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtggggttcccccgacaccgcccccggcggttgcgcacgacgccggcgatgcgccgtctg
gtatccgagacgtcgctggagccacggcatctcgtgctgccgatgttcgtggccgacggt
ctcgacgagccgcgcgacatcgcgtcgatgcccggggtggtgcagcacacccgagagtcg
ttgcgccgcgccgccgccgaggcggtcgaggccggtgtgggcggcctgatgctcttcggc
gtgcccagggacgaggacaaggacgcgacgggcagcatcggcgtcgatccggacggcatc
ctcaaccgcgcactgcgggacctgaccagggatctcggtgacgacaccgtgctgatggcc
gacacctgtctcgacgagttcaccgaccacggtcactgcggggtggtggacccgacgggc
cgcgtcgacaacgatctgaccaaccgtcgctacgtcgaacttgcagtggcccaagcgaat
tcaggggcgcaggtggtcagcccaagcggcatgatggacggtcaggtggccgccatccgg
gacggtctggacgtcgccggctacacgcacaccgcgatcctggcctactccgcgaagttc
gcctcgggtttctacgggccgttccgcgaggcggtgggctccagcctggagggcgaccgc
cgcacctaccaacaggatcccggcaacggccgggaggcgctgcacgaggttcggctcgac
atcgaggagggcgccgacatcgtgatggtcaaacccgcgatgtcctacctcgacgtggtg
cgggcgaccgccgagatatgcccgttgccgctggccgcctatcaggtgtcgggggagtac
tcgatgatcgcggccgcggccgagaagggctggatcgatctgcccaccgtcgtactggag
tcgctggtcgggatccggcgcgccggcgccgacatcgtgctgagctactgggccgtcgac
gtggcccgttggctgacgtga

DBGET integrated database retrieval system