KEGG   Mycobacterium gilvum Spyr1: Mspyr1_09050Help
Entry
Mspyr1_09050      CDS       T01376                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
msp00360  Phenylalanine metabolism
msp00362  Benzoate degradation
msp00620  Pyruvate metabolism
msp00621  Dioxin degradation
msp00622  Xylene degradation
msp00650  Butanoate metabolism
msp01100  Metabolic pathways
msp01120  Microbial metabolism in diverse environments
msp01220  Degradation of aromatic compounds
Module
msp_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mspyr1_09050
   00650 Butanoate metabolism
    Mspyr1_09050
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Mspyr1_09050
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mspyr1_09050
   00622 Xylene degradation
    Mspyr1_09050
   00621 Dioxin degradation
    Mspyr1_09050
Enzymes [BR:msp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Mspyr1_09050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ADT97597
UniProt: E6TDL7
Position
921573..922493
Genome map
AA seq 306 aa AA seqDB search
MADKLSVAIVGSGNISTDLLYKLLRSEWLEPRWMIGIDPESEGLARARKLGLETSHEGVD
WLLARDEKPDMVFEATSAYVHRDAAPRYAEAGIRAIDLTPAAIGPGVIPPANLREHLDAP
NVNMVTCGGQATIPMVHAVSRVVDVPYAEIVASVSSASAGPGTRANIDEFTKTTSAGVEV
IGGAKRGKAIIILNPADPPMIMRDTIFCAIPEDADHAAITQSVKDVVAEVQTYVPGYRLL
NEPQFDEPSVVNGGNHLVTIFVEVEGAGDYLPPYAGNLDIMTAAAAKVGEEIARERAATS
TTGAQA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaaattgtccgtggcgatcgtggggtcgggaaacatcagtaccgatctgctc
tacaagctgttgcgttcggaatggcttgagccgcgctggatgatcggcatcgacccggag
agtgaggggctcgcgcgggcccgcaagctcggtctggagacctcgcacgagggtgtcgac
tggctgctcgcgcgcgacgagaaaccggacatggtcttcgaggcgacgagcgcctacgtg
caccgcgacgccgcgccgcgctacgccgaggcgggcatccgcgccatcgatctgaccccg
gcggccatcggccccggcgtgattcctccggccaatctgcgcgaacacctcgacgccccg
aacgtcaacatggtgacctgcggtgggcaggcgaccattccgatggtccacgccgtatcg
cgtgtcgtggacgtgccgtacgccgagatcgtcgcgtcggtgtcgtcggcctcggccggt
ccgggaacccgcgccaacatcgacgagttcaccaagaccaccagcgccggcgtcgaggtg
atcggtggggccaagcgtggcaaggccatcatcatcctgaatccggccgatccgccgatg
atcatgcgcgacaccatcttctgcgcgatcccggaggacgccgaccacgctgcgatcacg
cagtcggtcaaagacgtcgtcgccgaggtgcagacctacgtccccggctaccggttgctc
aacgaaccgcagttcgacgaaccctcggtggtcaacggaggaaaccacctggtcacgatt
ttcgtcgaagtggagggtgcgggagactatctgccgccctacgctggaaacctggacatc
atgaccgccgcagcggccaaggtgggcgaagaaatcgccagggaacgcgccgcaacgtcc
acgactggagcgcaggcatga

DBGET integrated database retrieval system