KEGG   Mycobacterium gilvum Spyr1: Mspyr1_09050Help
Entry
Mspyr1_09050      CDS       T01376                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mspyr1_09050
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mspyr1_09050
   00650 Butanoate metabolism
    Mspyr1_09050
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Mspyr1_09050
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mspyr1_09050
   00622 Xylene degradation
    Mspyr1_09050
   00621 Dioxin degradation
    Mspyr1_09050
Enzymes [BR:msp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Mspyr1_09050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
921573..922493
Genome map
AA seq 306 aa AA seqDB search
MADKLSVAIVGSGNISTDLLYKLLRSEWLEPRWMIGIDPESEGLARARKLGLETSHEGVD
WLLARDEKPDMVFEATSAYVHRDAAPRYAEAGIRAIDLTPAAIGPGVIPPANLREHLDAP
NVNMVTCGGQATIPMVHAVSRVVDVPYAEIVASVSSASAGPGTRANIDEFTKTTSAGVEV
IGGAKRGKAIIILNPADPPMIMRDTIFCAIPEDADHAAITQSVKDVVAEVQTYVPGYRLL
NEPQFDEPSVVNGGNHLVTIFVEVEGAGDYLPPYAGNLDIMTAAAAKVGEEIARERAATS
TTGAQA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaaattgtccgtggcgatcgtggggtcgggaaacatcagtaccgatctgctc
tacaagctgttgcgttcggaatggcttgagccgcgctggatgatcggcatcgacccggag
agtgaggggctcgcgcgggcccgcaagctcggtctggagacctcgcacgagggtgtcgac
tggctgctcgcgcgcgacgagaaaccggacatggtcttcgaggcgacgagcgcctacgtg
caccgcgacgccgcgccgcgctacgccgaggcgggcatccgcgccatcgatctgaccccg
gcggccatcggccccggcgtgattcctccggccaatctgcgcgaacacctcgacgccccg
aacgtcaacatggtgacctgcggtgggcaggcgaccattccgatggtccacgccgtatcg
cgtgtcgtggacgtgccgtacgccgagatcgtcgcgtcggtgtcgtcggcctcggccggt
ccgggaacccgcgccaacatcgacgagttcaccaagaccaccagcgccggcgtcgaggtg
atcggtggggccaagcgtggcaaggccatcatcatcctgaatccggccgatccgccgatg
atcatgcgcgacaccatcttctgcgcgatcccggaggacgccgaccacgctgcgatcacg
cagtcggtcaaagacgtcgtcgccgaggtgcagacctacgtccccggctaccggttgctc
aacgaaccgcagttcgacgaaccctcggtggtcaacggaggaaaccacctggtcacgatt
ttcgtcgaagtggagggtgcgggagactatctgccgccctacgctggaaacctggacatc
atgaccgccgcagcggccaaggtgggcgaagaaatcgccagggaacgcgccgcaacgtcc
acgactggagcgcaggcatga

DBGET integrated database retrieval system