KEGG   Mycobacterium gilvum Spyr1: Mspyr1_10050Help
Entry
Mspyr1_10050      CDS       T01376                                 

Definition
glutathione peroxidase (EC:1.11.1.12)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Mspyr1_10050
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Mspyr1_10050
Enzymes [BR:msp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Mspyr1_10050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1025940..1026434
Genome map
AA seq 164 aa AA seqDB search
MTSALTAIPLTTLDGRSTTLAELADGAALVVNVASKCGLTPQYTALEQLAKDYGPRGLTV
IGVPCNQFMGQEPGSAEEIQEFCSTTYGVTFPLLAKTDVNGADRHPLYAELTKTADDAGE
AGDVQWNFEKFLLAPGGEVVKRFRPRTTPDDPAVIAAIDDVLGT
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgcgctcaccgcaatcccgctcacgacgctcgacggccggtcgaccacgttg
gccgagttggccgacggcgccgcgctcgtcgtcaacgtcgcctccaagtgcggtctgaca
ccgcagtacaccgcactcgaacagctcgccaaggactacggcccgcgcgggctgacggtg
atcggggtgccgtgcaaccagttcatggggcaggagccgggcagcgccgaggagatccag
gagttctgctccaccacctacggcgtgacgttccccctgctggcgaaaaccgacgtcaac
ggcgccgaccgccatccgctgtacgccgagctcaccaagaccgccgacgacgccggagag
gccggcgacgtgcagtggaacttcgaaaagttcctgctcgcccccggcggcgaggtcgtc
aagcggttccgaccccgcaccacccccgacgatcccgccgtgatcgcggcgatcgacgac
gtgctgggaacgtag

DBGET integrated database retrieval system