KEGG   Mycobacterium gilvum Spyr1: Mspyr1_10050Help
Entry
Mspyr1_10050      CDS       T01376                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
msp00480  Glutathione metabolism
msp00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Mspyr1_10050
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Mspyr1_10050
Enzymes [BR:msp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Mspyr1_10050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ADT97694
UniProt: E6TF41
Position
1025940..1026434
Genome map
AA seq 164 aa AA seqDB search
MTSALTAIPLTTLDGRSTTLAELADGAALVVNVASKCGLTPQYTALEQLAKDYGPRGLTV
IGVPCNQFMGQEPGSAEEIQEFCSTTYGVTFPLLAKTDVNGADRHPLYAELTKTADDAGE
AGDVQWNFEKFLLAPGGEVVKRFRPRTTPDDPAVIAAIDDVLGT
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgcgctcaccgcaatcccgctcacgacgctcgacggccggtcgaccacgttg
gccgagttggccgacggcgccgcgctcgtcgtcaacgtcgcctccaagtgcggtctgaca
ccgcagtacaccgcactcgaacagctcgccaaggactacggcccgcgcgggctgacggtg
atcggggtgccgtgcaaccagttcatggggcaggagccgggcagcgccgaggagatccag
gagttctgctccaccacctacggcgtgacgttccccctgctggcgaaaaccgacgtcaac
ggcgccgaccgccatccgctgtacgccgagctcaccaagaccgccgacgacgccggagag
gccggcgacgtgcagtggaacttcgaaaagttcctgctcgcccccggcggcgaggtcgtc
aagcggttccgaccccgcaccacccccgacgatcccgccgtgatcgcggcgatcgacgac
gtgctgggaacgtag

DBGET integrated database retrieval system