KEGG   Mycobacterium gilvum Spyr1: Mspyr1_12760Help
Entry
Mspyr1_12760      CDS       T01376                                 

Definition
Mg-chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mspyr1_12760
Enzymes [BR:msp01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mspyr1_12760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1302212..1303603
Genome map
AA seq 463 aa AA seqDB search
MTSPNDLPRTVGELRASGHRERTVKAEIRENLLAALASGAPVDEVWPGILGFEDTVLPQL
ERALIAGHDIVLLGERGQGKTRLLRGLTGMLDEWTPVIAGAELGEHPYSPITPESIRRAA
DFGDDLPIAWRHRSERYTEKLATPDTSVADLVGDIDPIKVAEGRSLGDPETIAYGLIPRA
HRGIVAVNELPDLAERIQVAMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGRI
ITPLKDRFGAEIRTHYPLELDAEVGVIVQEAHMAAEVPDYLLQILARFARALRESSSVDQ
RSGVSARFAIAAAETVAASARHRAAVLNEQEPVARVVDLASILDVLRGKLEFESGEEGRE
QAILEHLLRRATAETAQRLLGGIDVGPIVTAVEGGSPVTTGDRVSARDVLAALPEVSAVA
EIQQRLGAQTDGQRAAAIELALEALYLAKRIDKVSDQGETVYG
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcacctaacgacctcccccgcaccgtcggcgaactgcgcgcgtccggacaccgc
gaacgcaccgtcaaggccgagatccgggagaatctgctggcggcgctcgcgtcgggcgct
cccgtcgacgaggtgtggcccggcatcctgggcttcgaggacaccgtcctgccgcagctg
gagagggccctgatcgccgggcacgacatcgtgctgctcggcgagcgcgggcagggcaag
acccgcctgctgcgcgggctgaccgggatgctcgacgaatggacgccggtgatcgcgggc
gccgagctcggagaacacccgtacagcccgatcacgccggaatcgatccgccgggccgcg
gacttcggtgacgacctcccgatcgcgtggcggcaccgcagcgagcgctacaccgagaag
ctggccacccccgacacgagtgtggccgacctcgtcggtgacatcgacccgatcaaggtg
gccgagggccgcagcctcggtgaccccgagaccatcgcctacgggctcatcccgcgcgca
caccgcggcatcgtcgccgtcaacgagctcccggacctggccgaacgcatccaggtcgcg
atgctcaacgtgatggaggaacgcgacatccaggtgcgcggctacacgttgcgtctgccg
ctcgacgtgctcgtcgtcgccagcgccaaccccgaggactacacgaaccgggggcgcatc
atcaccccgctgaaggaccggttcggcgccgagatccgcacgcactacccgctggagctc
gacgccgaggtcggcgtcatcgtgcaggaggcgcacatggcggccgaggtgccggactat
ctgctgcagatcctggcccggttcgcccgcgcgctgcgcgaatccagttcggtcgaccag
cggtccggcgtctccgcccgcttcgcgatcgcggccgccgagaccgtcgccgcctcggcc
cggcaccgcgccgcggtactcaacgagcaggagccggtggcccgcgtggtcgacctggcg
tcgatcctcgacgtgctgcggggcaagctggagttcgagtccggtgaggaaggtcgcgag
caggcgatcctggagcatctgctgcgccgcgccacggccgagacggcgcagcggctcctc
ggcgggatcgacgtcggcccgatcgtcaccgcggtcgagggcggatcgcctgtcaccacc
ggcgaccgggtctcggcccgcgacgtgttggccgcgctgcccgaggtgtcggccgtcgcc
gagatccagcagcgcctcggcgctcagaccgacgggcagcgggccgcggcgatcgagctg
gccctcgaagcgctctatctggccaagcggatcgacaaggtgtccgaccagggcgagacg
gtctacggctga

DBGET integrated database retrieval system