KEGG   Mycobacterium gilvum Spyr1: Mspyr1_12980Help
Entry
Mspyr1_12980      CDS       T01376                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mspyr1_12980
   00052 Galactose metabolism
    Mspyr1_12980
   00500 Starch and sucrose metabolism
    Mspyr1_12980
   00520 Amino sugar and nucleotide sugar metabolism
    Mspyr1_12980
Enzymes [BR:msp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mspyr1_12980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1325462..1326382
Genome map
AA seq 306 aa AA seqDB search
MNRPEVPVPRTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAEAGAERLII
ITSEGKDGVVAHFVEDLVLEGTLEARGKKTMLEKVRRAPALIKVESVVQAEPLGLGHAVG
CVEASLAPDEDAIAVLLPDDLVLPTGVLETMAKVRAKRGGSVLCAIEVDREDISAYGVFD
VETVPDAANPNVLRVKGMVEKPKAEDAPSLFAAAGRYILDRAIFDALKRIPRGAGGELQL
TDAIALLIEEGHPVHVVVHRGSRHDLGNPGGYLKAAVDFALERDDYGPELRRWLVERLGL
PAGTEG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaatcggcctgaggttcctgttccgcgcaccgcggtggtacccgcggcgggcctggga
acgcgcttcctgcccgccaccaagacggtgcccaaggagctgctgcccgtcgtcgacaca
ccgggcatcgagctcgtggccgccgaagccgccgaggccggcgccgagcggttgatcatc
atcacctcggagggcaaggacggcgtcgtcgcgcatttcgtcgaggacctggtcctcgag
ggcacgctggaagcccggggcaagaagaccatgctcgaaaaggtccggcgcgcaccggca
ttgatcaaggtggagtcggtcgtgcaggccgagccgctcggactcggacacgccgtcggc
tgtgtcgaggccagtctcgcgcccgacgaggatgcgatcgcggtcctcctgcccgacgat
ctcgtgctgcccaccggcgtgctggagacgatggccaaggtgcgcgccaagcgcggtgga
tctgtgctgtgcgcgatcgaggtcgaccgcgaggacatcagcgcctatggcgtgttcgac
gtcgagaccgtgcccgacgccgccaaccccaacgtcctgcgggtcaagggaatggtggag
aagccgaaggccgaggatgcgccgtcgctgttcgccgccgcgggccgctacatcctcgac
cgtgcgatcttcgacgcgctcaagcgcatcccccgcggcgccggcggcgaattgcagctg
accgatgcgatcgcgctgctgatcgaagaagggcacccggtccacgtcgtcgtgcaccgc
ggatctcgacacgatcttggaaatcccgggggctacctcaaggctgcggttgactttgcg
ttggagcgggacgactacgggcctgaacttcgccggtggttggtcgaacgactggggctt
ccggcggggaccgaaggctag

DBGET integrated database retrieval system