KEGG   Mycobacterium gilvum Spyr1: Mspyr1_13370Help
Entry
Mspyr1_13370      CDS       T01376                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mspyr1_13370
Enzymes [BR:msp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Mspyr1_13370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1362768..1363736
Genome map
AA seq 322 aa AA seqDB search
MSARDGNTASEWVPTGSVTVRVPGKVNLYLDVGDRRQDGYHELTTVFHAVSLLDEVTVRT
ADTLSLEHVGEGADSLPTDERNLAWRAAELMAEHVGRAPDVAISIEKTIPVAGGMAGGSA
DAAAVLVAMNSLWELGVPRRDLHALAAQLGSDVPFALHGGTALGTGRGEELATVLTRNTF
HWVLAFSPGGLSTAKVFAEIDRLRAEEDRTLPPRLESPEPVLAALASGDPAQLAPLLGND
LQPAALSLDPALRRTLRAGLDAGALAGLVSGSGPTCAFLCTSAGAAVDIGTDLAGAGVCR
TVRVASGPVQGARVVPAPSTAG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgcgcgcgacggtaatacggcatcggagtgggttcccacgggttcggtcaccgtc
cgcgtgcccggcaaggtcaatctctatctcgacgtcggtgaccgtcggcaggacggctac
cacgagctgacgaccgtcttccacgccgtatcgctgctcgacgaggtcacggtgcggacc
gccgacacgctgtcgctggagcacgtcggagagggcgccgactcgctccccaccgacgag
cgcaatctcgcctggcgcgccgcggaactgatggccgagcatgtcggccgcgcgcccgat
gtcgcgatctcgatcgagaagaccatcccggtggccggcgggatggcgggcggcagcgcc
gatgcggcggccgtactggtcgcgatgaattcgctctgggagctcggggtgccgcggcgc
gatctgcatgcgctcgccgcccagttgggtagcgacgtgccgttcgcgctgcacggcggt
acggcgctgggcaccggtcgcggcgaggaactcgcgacggtgctgacccgcaacacgttc
cattgggtgctcgcgttctcacccggtggcctgtcgaccgccaaggtcttcgccgagatc
gaccggctgcgcgccgaggaggaccgcacccttccaccccgtctggagtcgcccgagccc
gtgctggcggcgctggcgtccggtgatccggcgcagctggcgccgctgctcggcaacgat
ctgcagccggcggcgctgagccttgacccggcgctgcgccggactctgcgcgcgggtctc
gacgccggcgcgctggctggtctggtgtccggatccggccccacctgcgcgttcctgtgc
acgtcggccggcgccgccgtcgacatcgggaccgatctggcgggcgcgggggtgtgtcgc
accgtccgcgtggccagcggaccggtgcagggcgcgcgggtcgtaccggccccgtcgacc
gccggctga

DBGET integrated database retrieval system