KEGG   Mycobacterium gilvum Spyr1: Mspyr1_14600Help
Entry
Mspyr1_14600      CDS       T01376                                 

Definition
(RefSeq) short chain enoyl-CoA hydratase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Mspyr1_14600
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mspyr1_14600
   00650 Butanoate metabolism
    Mspyr1_14600
  Lipid metabolism
   00071 Fatty acid degradation
    Mspyr1_14600
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mspyr1_14600
   00310 Lysine degradation
    Mspyr1_14600
   00360 Phenylalanine metabolism
    Mspyr1_14600
   00380 Tryptophan metabolism
    Mspyr1_14600
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mspyr1_14600
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mspyr1_14600
   00281 Geraniol degradation
    Mspyr1_14600
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mspyr1_14600
   00627 Aminobenzoate degradation
    Mspyr1_14600
   00930 Caprolactam degradation
    Mspyr1_14600
Enzymes [BR:msp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mspyr1_14600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1481496..1482269)
Genome map
AA seq 257 aa AA seqDB search
MTFETILVDRDDRVATITLNRPKALNALNTQVMNEVTTAAAELDAEPGVGAIIVTGSERA
FAAGADIKEMASLSFADVFSSDFFAAWGKFAATRTPTIAAVAGYALGGGCELAMMCDILI
AADTAKFGQPEIKLGVLPGMGGSQRLTRAIGKAKAMDLILTGRNMDAEEAERAGLVSRVV
PADSLLSEAKAVAQTIAGMSLSASRMAKEAVDRAFETTLSEGLLYERRLFHSAFATDDQT
EGMNAFSEKRSPNFTHR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgactttcgagaccatcctggtcgaccgcgacgaccgcgtcgcgacgatcacgctgaac
cggccgaaggcgctcaacgcgctcaacacccaggtgatgaacgaagtcaccacggccgca
gccgagctcgatgccgagcccggcgtcggcgccatcatcgtcaccggaagcgagagggcg
ttcgcggcaggggccgacatcaaggagatggcctcgctgtcgttcgccgatgtcttctcc
tccgacttcttcgccgcgtggggcaaattcgccgccacccgcaccccgacgatcgccgcg
gtggccggttacgcgctgggcggcggctgcgagctcgcgatgatgtgcgacatcctgatc
gccgccgacaccgcgaagttcgggcagcccgagatcaagctcggcgtgctgcccggcatg
ggcggatcgcaacggctgacgcgcgcgatcggcaaggccaaggcgatggacctgatcctg
accggccgcaacatggacgccgaggaggccgagcgcgcgggcctggtctcacgcgtcgtt
ccggcggactcgctgctgtcggaggccaaggccgtcgcacagacgatcgcggggatgtcg
ctgtcggcatcgcggatggccaaggaggccgtcgaccgggcattcgagacgacactgtcc
gaaggcctgctgtatgagcgccggttgttccactcggcgttcgccaccgacgaccagacc
gaggggatgaacgcgttcagcgagaaacgttcgccgaacttcacccatcgctag

DBGET integrated database retrieval system