KEGG   Mycobacterium gilvum Spyr1: Mspyr1_17040Help
Entry
Mspyr1_17040      CDS       T01376                                 

Definition
3'-phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Mspyr1_17040
Enzymes [BR:msp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Mspyr1_17040
Transfer RNA biogenesis [BR:msp03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Mspyr1_17040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1733888..1734634
Genome map
AA seq 248 aa AA seqDB search
MTDDHELAGRLATAAGALLLDVRAELAEATPEERKAAGDKRAHDFLLAALTAERPEDAVL
SEEGVDDPVRLSAQRVWIVDPLDGTREFSELGRTDWAVHVALWERTGSGGELVAGAVALP
AQGVTLVTPTVVAPPAGPSSPRVVVSRTRPPAVALDVKDALNGTLVEMGSAGAKVASVVQ
GLSDVYVHAGGQYEWDSAAPVAVARAAGLHTSRIDGSPLVYNQRDSKLPDLIVCRPELAD
AVLAVTTR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgactgacgaccacgagcttgcgggccggctggccaccgcggccggcgcgttgctgctc
gacgtccgtgccgagctcgccgaggcgacgcccgaggagcggaaagcggccggggacaag
agggctcacgatttcctgctggctgcgctgaccgccgaacgtcctgaggatgcggtcctg
tcggaggaaggcgtggacgacccggtgcggctgtccgcgcagcgggtgtggatcgtcgac
ccgctggacggcacccgcgagttctccgagctcgggcgcacggactgggctgtgcacgtc
gcgctgtgggagcgcaccggaagcggcggcgagctcgtcgccggggcggtggcacttccc
gcccagggtgtcacgctggtgaccccgacggtggtggcgccgcccgccggtccgtcgtct
ccgcgcgtcgtggtgtcacgcacccggccgccggccgtcgcgctggacgtcaaggatgcg
ctgaacggcactctggtcgaaatgggttcggcgggagccaaagtcgcgtctgtcgtgcag
ggactgtccgacgtctacgtgcatgccggcggtcagtacgagtgggactcggcggcgccg
gtcgccgtcgcccgggccgcgggtctgcacacctcccgcatcgacggctcgccgttggtc
tacaaccagcgcgactccaagctgcccgacctcatcgtgtgccggcccgaattggccgac
gcggtgctggccgtcaccacgcgctga

DBGET integrated database retrieval system