KEGG   Mycobacterium gilvum Spyr1: Mspyr1_17310Help
Entry
Mspyr1_17310      CDS       T01376                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mspyr1_17310
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mspyr1_17310
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mspyr1_17310
Enzymes [BR:msp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mspyr1_17310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1761559..1762638
Genome map
AA seq 359 aa AA seqDB search
MSATRAVHQPWPGLIEAYRDRLPIEDSWTPITLREGGTPLLPAPRLSEYTGCTVHLKVEG
LNPTGSFKDRGMTMAVTEAVSRGQQAVLCASTGNTSASAAAYAARAGITCAVLVPQGKIA
MGKLAQAVMHGAKIIQIDGNFDDCLELARKLTADFPTVSLVNSVNPFRIEGQKTAAFEIV
DALGDAPDIHALPVGNAGNITAYWKGYTEYHRDGLASRLPRMLGTQAAGAAPLVLGEPVS
DPETIATAIRIGSPASWSSAVEAQQQSDGRFLAATDEEILAAYHLVARAEGVFVEPASAA
SIAGLLKAIEEGWVAKGSTVVCTVTGNGLKDPDTALKGMPAVIPVPVDPVAVVAKLGLV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccacccgagccgtacatcagccgtggccgggcctcatcgaggcctaccgcgat
cggctgccgatcgaggacagctggacccccatcacgctccgtgaaggtggcaccccgctg
ctgccggcgccgcggctgtccgaatacacagggtgcaccgtgcatctcaaggtcgagggg
ctcaaccccaccggttcgttcaaggaccggggcatgacgatggccgtgaccgaagcggtc
tcgcggggacagcaggcggtgctgtgcgcgtcgaccggcaacacctcggcctcggccgcc
gcgtacgcggcacgcgcgggcatcacctgtgcggtgctggtgccccagggcaagatcgcg
atgggcaaactggcacaggcagtgatgcacggcgccaagatcattcagatcgacggcaat
ttcgacgactgcctggagctcgcgcgcaagctcaccgccgacttcccgaccgtctcactc
gtcaactccgtcaacccgttccggatcgaaggacagaagaccgcggcgttcgagatcgtc
gacgccctcggagacgcacccgacatccacgcgcttcccgtcggcaacgcaggcaacatc
accgcctactggaagggctataccgagtatcaccgcgacggtctggcttcacggctgccg
cgcatgctcgggacacaggccgccggcgccgcaccgctggttctcggggaaccggtcagc
gatcccgagaccatcgcgaccgcgatccggatcgggtcgcccgcgtcgtggagctccgcg
gtggaagcccagcagcagtccgacggacgcttcctggccgccacggacgaggaaatcctc
gccgcctaccacctcgtcgcacgcgcagagggcgtgttcgttgagcccgcgtcggcggcg
agcatcgccggactgctcaaggccatcgaagagggttgggtcgccaaggggtccactgtc
gtgtgcaccgtcaccggtaacgggttgaaggacccggacaccgcgctcaagggcatgccc
gccgtcatccccgtcccggtcgacccggtcgccgtcgtcgccaagctcggtctggtctag

DBGET integrated database retrieval system