KEGG   Mycobacterium gilvum Spyr1: Mspyr1_18070Help
Entry
Mspyr1_18070      CDS       T01376                                 

Definition
nucleoside-diphosphate-sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
msp  Mycobacterium gilvum Spyr1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1839150..1840166
Genome map
AA seq 338 aa AA seqDB search
MAGTKLVIGASGFLGSHVTRQLVADGDADVRVLIRRTSSTRGIDGLPVEVRYGDIFDADA
LRTAMSGCDVVYYCVVDARPWLRDPRPMWRTNVDGLRTVLDIAADAGLTRFVFTSSIGTI
GLRAGGPADERTEHNWLDRGGEYIRSRVVAEEMVLRDSARNRLPGVAMCVANTYGPGDFQ
PTPHGAMLAAAVRGKLPFYIRGYEAEAVGIEDAARAMILAGERGRIGERYIVSDRFISTR
EIHEIGCAAVGMRPPRFGVPIRAMAAAAHLGAAVARVRNTDTMLTPLNIRLMHIMTPLDH
SKAVRELGWHPRPLADSIVSAAHFFTDRRRSAAPEGTR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaacgaagctggtgatcggtgccagcggtttcctcggctcccacgtcaccagg
caactggtcgccgacggcgacgcggacgtgcgggtgctgatccggcggaccagttcgacc
cgcgggatcgacggtctgcccgtcgaggtccgctacggcgacatcttcgacgccgacgca
ctgcgcaccgcgatgtcgggatgcgatgtcgtctactactgcgtggtcgacgcgaggccc
tggttgcgcgatccgcggccgatgtggcggacgaacgtcgacggtctgcgcacagtgctc
gacatcgccgccgacgccggtctcacccggttcgtcttcaccagttccatcgggaccatc
gggttgcgggccggtgggccggccgatgagcgcaccgaacacaactggctcgaccgcggc
ggggagtacatccggtccagggtcgtggccgaggagatggtgctgcgcgacagcgcccgg
aacaggctcccgggcgtggcgatgtgcgtggccaacacctacggacccggcgacttccag
ccgacaccacacggggcgatgctggccgccgcggtgcgcggcaagctgccgttctacatc
cggggctacgaggccgaggcggtcggcatcgaggatgccgcccgagcgatgatccttgcc
ggcgaacgcggccggatcggcgagcggtacatcgtgtcggaccggttcatcagcacccgg
gagatccatgagatcggttgcgcggcagtgggcatgaggccaccgaggttcggcgtgcct
attcgggcgatggcggccgccgcccatctgggcgcggctgtcgcacgggtgcggaacacg
gacaccatgctcaccccgctgaacatccgcctgatgcacatcatgacgccgctggaccat
tccaaggccgttcgcgagctcggttggcacccgcgaccgctcgcggactcgatcgtctcg
gccgcgcacttcttcaccgaccggagacgatccgccgcccccgagggaacccgatga

DBGET integrated database retrieval system