KEGG   Mycobacterium gilvum Spyr1: Mspyr1_20900Help
Entry
Mspyr1_20900      CDS       T01376                                 

Definition
(RefSeq) fructose-2,6-bisphosphatase
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mspyr1_20900
   01230 Biosynthesis of amino acids
    Mspyr1_20900
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mspyr1_20900
  Energy metabolism
   00680 Methane metabolism
    Mspyr1_20900
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mspyr1_20900
Enzymes [BR:msp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     Mspyr1_20900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2141721..2142395
Genome map
AA seq 224 aa AA seqDB search
MTIRRLVMLRHGQTEYNAGSRMQGQLDTDLSDLGREQAASAADALAKRHPLLIVSSDLRR
ALDTAVVLGDRCGQPVSIDARLRETHLGDWQGMTHLEVDEVAPGARLAWRDDARWAPHGG
ESRIDVARRSLPLVRELVTQQTEWGSAGDRPVVLVAHGGLIAALTAALLGLPADNWPVLG
GMGNASWVQLAGHTRADGDPASFDDIRWRLDVWNASAQVAGDVL
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatccggcggctggtcatgctccggcacggccagaccgagtacaacgcgggaagc
cgcatgcagggccaactcgacaccgatctcagcgatctgggccgagagcaggccgcatcc
gcggccgatgccctggccaaacgccacccgctgctgatcgtgtcctcggatctgcggcgc
gccctcgacaccgcggtcgtgctcggcgaccggtgcggacaaccggtcagcatcgacgcc
cggctgcgtgagacgcacctcggggactggcaggggatgacgcatctggaggtcgacgag
gtcgcgcccggcgcgcggctggcgtggcgcgacgacgcccgttgggccccgcacggcggc
gagagccgcatcgatgtcgcccggcggagcctgcctctggtgcgcgagctggtgacgcag
cagaccgagtggggatcggcgggggaccggccggtggtgctcgtcgcgcacggcgggctc
atcgccgcgctgacggcggcactgctcgggctgcccgccgacaactggccggtactgggc
ggcatgggtaacgcgagctgggtgcagctggccggccacacccgggccgacggcgatccg
gcatccttcgacgacatccggtggcgtctcgacgtgtggaacgcctcggcgcaggttgcc
ggcgatgtcctctga

DBGET integrated database retrieval system