KEGG   Mycobacterium gilvum Spyr1: Mspyr1_22670Help
Entry
Mspyr1_22670      CDS       T01376                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mspyr1_22670
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mspyr1_22670
  Amino acid metabolism
   00310 Lysine degradation
    Mspyr1_22670
Enzymes [BR:msp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mspyr1_22670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2343661..2345523)
Genome map
AA seq 620 aa AA seqDB search
MAISVQMPALGESVTEGTVTRWLKQEGDTVEEDEPLLEVSTDKVDTEIPSPASGVLKKIV
AQEDDTVEVGGELAVIGDADDSDSDDSDSDDAGDSDDSEAEDSGDEAEPAAEESEPEPEP
EPEDEDEPEPEPKKKSSGGSGSSGSGTSVTMPELGESVTEGTVTRWLKEVGDTVEVDEPL
VEVSTDKVDTEIPSPVAGTLLSITAEEDDTVEVGGELAKIGDAGAEEESEPEPEPEPEPE
PEPEPEPEPEPEPKQTKPESKPSEEAAPEPKSESKPEAESKPEPKPKPEPEPKRESKPEA
ESSGDSPYVTPLVRKLAGEHGVDLASVKGTGVGGRIRKQDVLAAAEKSKAPKEDAPKAEP
AAEAPGKTTQAPAPEGALAHLRGTTQKANRIRQITAKKTRESLQTTAQLTQVHEVDMTRI
VALRAKAKAGFAEREGVNLTYLPFIARAVIDALKLHPNVNASYNEESKEITYHEAEHLGI
AVDTEQGLLSPVIHNAGDLSLGGLARAISDIAGRARSGNLKPDELSGGTFTITNIGSQGA
LFDTPILVPPQAAMLGTGAIVKRPRIIVDEFGNESIGVRSVSYLPLTYDHRLIDGADAGR
FVTTIKRRLEEGAFEADLGL
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggcaatctccgtccagatgcccgcactcggagagagcgttaccgaggggaccgtcacc
cgctggttgaagcaggagggagacacggtcgaggaggacgagccactgctcgaggtgtcg
accgacaaggtcgacaccgagatcccgtctccggcatcaggtgtgttgaagaagatcgtc
gcgcaggaggacgacaccgtcgaggtcggcggagagctcgccgtgatcggcgacgccgac
gacagtgactccgacgacagtgactccgacgatgccggcgacagtgacgacagcgaggcc
gaggacagcggcgacgaggccgaacctgccgccgaggaatccgagcccgagcccgagccg
gaacccgaagacgaagacgagcccgaacccgagcccaagaagaagtcctcgggcggatcc
gggtcctccggatcggggacgtcggtgacgatgcccgagctcggcgagtcggtcaccgaa
ggcaccgtgacgcggtggctgaaggaggtcggcgacaccgtcgaggtcgacgagccgctc
gtcgaggtgtccaccgacaaggtcgacaccgagatcccgtcgcccgtcgccggcactctg
ctgtcgatcacggccgaggaggacgacaccgtcgaggtcggcggagagctcgccaagatc
ggtgacgcgggcgccgaggaagaatccgagccggaaccggaaccggaaccggagcccgaa
cccgagcccgaacccgagcctgaacccgagcccgagccgaagcagacgaagcccgagtcc
aagccctccgaggaggcggcacccgagcccaagtccgagtccaagcccgaagccgagtcc
aagcccgagcccaagccgaagcccgaaccggagcccaagcgcgagtcgaagcccgaagcc
gagtcgtcgggcgacagcccctacgtgacgccgctggtgcgcaagctggccggtgagcac
ggcgtcgacctcgcgtcggtcaagggcaccggtgtcgggggacgcatccgcaagcaggac
gtgctcgcggccgccgagaagagcaaggcgcccaaggaggacgccccgaaggcggaaccg
gccgccgaggctccgggcaagaccactcaggcaccggcgccggagggcgcgctggcccac
ctgcgcggcacgacgcagaaggccaaccggatccggcagatcacggccaagaagacccgg
gagtcgctgcagaccacggcacagctgacccaggtccacgaggtcgacatgaccaggatc
gtcgcgctgcgggccaaggccaaggcgggcttcgccgagcgcgagggtgtcaacctgacc
tacctgccgttcatcgccagagcggtcatcgacgcgttgaagctgcatccgaacgtcaac
gccagctacaacgaggaatccaaggagatcacctaccacgaggccgagcacctgggcatc
gccgtcgacaccgagcagggcctgctctccccggtgatccacaacgccggcgacctgtcg
ctgggcgggctggcgcgggccatctccgacatcgccgggcgtgcccgctcgggcaacctc
aagcccgacgagctgtccggcggcacgttcaccatcaccaacatcggcagccagggcgcg
ttgttcgacacaccgatcctggtcccgccgcaggcggcgatgctgggtaccggtgcgatc
gtcaagcgcccccgcatcatcgtcgacgagttcggtaacgagtcgatcggtgtgcgctcg
gtgagctacctgccgctgacctacgatcaccgcctcatcgacggtgccgacgcgggacgg
ttcgtgaccaccatcaagcggcgtctcgaagaaggtgcgttcgaggccgacctggggctg
tag

DBGET integrated database retrieval system