KEGG   Mycobacterium gilvum Spyr1: Mspyr1_23340Help
Entry
Mspyr1_23340      CDS       T01376                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
K01183  
chitinase [EC:3.2.1.14]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mspyr1_23340
   00520 Amino sugar and nucleotide sugar metabolism
    Mspyr1_23340
Enzymes [BR:msp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mspyr1_23340
    3.2.1.14  chitinase
     Mspyr1_23340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2413750..2420682
Genome map
AA seq 2310 aa AA seqDB search
MGYGRFVGRVGALAVALGIGLAVPAVAAAEPSDDSSAQSGGSDVGGPAKPDRVRATESAD
RSDDAGEPAGSDRDSAGPTDDSEDPEIDSGDREPLDEESDPVSDVEDPSVEDVPDATDSE
ASRRDGDSAEPRSENDRETPAARPTEPSAEPDDAAIAVSDRPADAAEPVAPSDDRGMHRA
TSADQDVQTLTVSSTPARSSGQTATVSTGLTDIVTTFLRVLGIGSSAGDGSAPLPVYEVV
TAVLGAIRREMDRLFANNGPSAVLGSTSQTAPGVVTGTVIASDHEGDDLVYSVVEAPTRG
TVTVDAAGRFTYTAGPSAAAAGADTFVIGVRDAGFHLISVTPTRTQVPVTITFGADGVAT
QTISTRAARATTASAATTATGTATGTIHHITTSGPDIVGFDPARDKLDLGDVSVHNFIVV
DTAEGVGFRNPWSGETTVLQGVSLSQLTVDSFVPIINDHLRQDLSGALAWEQGVTPKANT
VYARSHEVGQIDRVAFTAATDVVDFRYYGTREQLYMSDTPDGVVISNAGTGQALILQGVT
TSQLTAKNFVFHSAQVREDRLHQQLGIGTVPDSQVLPQGVTYAGTNTWPTTAGTGQPPTG
QTGTTTKISWQYGSHTTLNFDPGRDKLDFGWFKAHEFDVTEVAGSTKIAIAGNNQTYTLA
GVAIGELTTSNIIALDDSARTEWSNLIYGAGQTVSQPKLSVGDAVVSEGNSGTSTLTFTV
TMSKASTDTVTVSYSTSNGSATAAGGDYVPAVGTLTFTPGQTSKTVAVTVNGDTLVEFDE
QLTLTLSAPVNATIADGTGLGTIRNDDVDQAPTTPPTVSIADLTVTEGNGDHSHFMFVAT
LSKPSTETVTVRYATSNGTATAGVDYAATTGTVTFAPGVTTQLVHVDVLGDTVVEQNETF
FVTLTNPTGATIGDGVATGTITDDDTVVTPGTGGVNSGNPGDALWGEAFFAPYVDMGAWP
VPNLLALAQQRGISLLTLGFMQATPDGKLAWAGLSALTPDSDFDQARAINQSIAALQAAG
GDVMISLGGASGTSLAQWYAAHGLGPQALADAYAAVADTYKLNRIDFDIEGSAVAEPASI
ALNAQALRLLQQLRPDLEIWYTLPVLPSGLTADGLNVVRKAIEAGVTLDGVNIMAMDYGE
SAAPTSGPNAKTMGAWAIQAAESTHAQLSTLYSGYGQTFAWNQLGVTPMIGVNDVLTEVF
TVADSQALEDFARARGLGMLSMWSLNRDYPGNIGQVTTTTSGTNTPTGGFSAVFNDYGTV
NPISGPPPAISIADLTVAEGNGAGAHAMFVVTLDKPSTQTVTVRYATSNGTAVAGTDYVA
ATGTVTFAPGVTSQTVHVGILGDTVAEAAETFSVTLSNPTGATIADATAVGAITDDDGVT
PTPGGNASVKYTVNDNWGSGFTASVALTAGASGMNGWTVEFDSPAQISNIWNAEIVSRVG
NHYVVRNVSYNAQVAAGQTITFGFQASPGGGSATATNFTVNGAATGQPVVVPPKVSIADA
GVVESHSGTKNIVFVLTLDKPATSPVSVAYATSNGTATAGGDFTAASGVVTFAVGVTSQQ
ISVPVLGDTTVEADETFTVTLSNPSGVTIADGSAIGTITNDDVATPTPGNASASMAVNDN
WGSGFTATVTVKAGSSALNGWTVEFDTPAQIGNIWNAEIVSRVGNHYVVRNAAWNPKIAA
GQTVTFGFQASPGGGSATASNFTVNGQSAPAQPPTVSVADASVGESNSGTTQMTFVVTLS
RSSTSPVTVAYATSNGTATAGVDYTAKSGTVTFAPGVLSQQIQVSVTGDAAVEANETFTL
TLSNPAGATISDGSALGTIVNDDVAVPGNISLSISDASVTEGAPGVGVAPGWFSTSGNQI
VDSAGRPVQIAGVNWFGMESETFAPHGLWTRNYKEMMNEMAALDFNTIRLAYSSEMLHTG
AAPNGIDFGKNPDLAGLSALQIMDKIVGYAGEIGMRVILDHHRSSKGAGPNSNGLWYEGS
YTEAAWIDDWTMLAQRYANTPTVIGADLHNEPHAGTWGGGGATDWAAAAERAGNAVLSVN
SNWLIFVEGVADYQGHSYWWGGNLMGVKDRPIVLNTPNRVVYSPHDYPNSVYAQPWFQTA
NFGAALPDKFEQMWGYIYEQKIAPIYLGEFGTRLSDPKDVIWYEAITSYLSGDFDNDGTV
DIAAGTEDMSWTFWSWNPNSRDTGGILADDWRTVNTNKMAYLEAIQFDFDDSSPGVLAQF
VVSLAAPSTQVVTVQYATSNQTAGAGSDYAPATGTLTFQPGETHKTITVVVFADTVMEGN
ETFLVTLSSPAGATLADGSGTGTIRDRTIV
NT seq 6933 nt NT seq  +upstreamnt  +downstreamnt
atgggctacggacgttttgttggtcgcgtcggtgcgttagctgtggcgttggggatcgga
cttgccgtccccgccgttgctgccgcagaaccctcagacgactccagtgcacagtcgggg
ggctcggacgtgggaggcccggcaaagcccgatcgtgtgcgcgcgaccgaatctgccgat
cggtcggacgacgccggcgaacccgccgggtccgaccgcgacagcgccggtcccacagac
gattccgaggatccggagatcgattccggagaccgggaacccctcgacgaggagtcggat
ccggtatccgacgtcgaggatccgtccgtggaggacgtgcccgacgccaccgattccgag
gcgagccggcgcgacggcgactccgctgagccgcgttcggagaatgatcgggaaaccccg
gccgcacgcccgacggaaccctcggccgaacccgacgacgccgcgatcgccgtgtccgac
cgtcctgcggacgcggcggagccggtggcaccgtcggatgacagaggcatgcaccgggcg
acctcggccgaccaggacgtccagacgctgaccgtgtcctccacccccgcacggtcgagc
gggcagaccgccacggtgtccacggggttgaccgacatcgtcacgacattcctgcgcgtg
ttggggatcggctcctcggccggcgacggctcggctccactgcccgtctacgaggtcgtc
accgcggtgctcggggcgatccgacgggagatggacaggctcttcgccaacaacggcccg
tcggcggtgctgggctcgaccagtcagaccgctcccggtgtcgtgaccggaacggtgatc
gcgtccgatcacgagggggacgacctggtctactccgtggtcgaagcccccacgcggggg
accgtcaccgtcgatgccgccgggaggttcacctacaccgccggcccgtccgcggccgcc
gcgggtgccgacaccttcgtcatcggcgtccgcgacgccggcttccacctgatctccgtc
acacccaccaggacccaggttccggtcaccatcacgttcggcgccgacggcgttgccacc
cagacgatctcgaccagggctgccagggccaccaccgcgtcggcggccacgaccgcgacc
gggacggcgaccgggacgatccaccacatcaccacctccggacccgacatcgtcggattc
gatcccgccagggacaaactcgacctcggcgatgtgtcggtgcacaacttcatcgtcgtc
gacaccgccgaaggcgtcggattccgcaatccctggtccggcgagaccaccgtcctgcag
ggtgtctcgctgagccagctgaccgtcgacagcttcgtgccgatcatcaacgaccatctg
cgccaggacctttccggggcactggcctgggagcagggagtcaccccgaaggccaacacg
gtctacgcgcgctcacacgaggtcggacagatcgaccgggtcgcgttcaccgcggcgacc
gacgtcgtcgacttccggtactacggcacccgcgaacagctctacatgtccgacacgccc
gacggggtcgtgatctccaacgcggggaccgggcaggcgctgatcctgcagggagtgacc
acaagtcagctcaccgcgaagaacttcgtcttccacagcgcacaggtgcgcgaggaccgg
ttgcaccagcaactcggcatcggcacagtgcccgattcccaggtactgccgcagggcgtc
acctacgccgggaccaacacctggcccaccaccgccggcaccggccagccaccgacgggt
cagaccggcaccaccaccaagatctcgtggcagtacggcagccacaccacgctgaacttc
gatcccggcagggacaagctggacttcggctggttcaaggcgcacgagttcgacgtcacc
gaggtggccggatccaccaagatcgccatcgccggcaacaaccagacctacacgctggcc
ggtgtcgcgatcggcgagctcacgacaagcaacatcatcgctctcgacgacagcgcccgc
accgagtggagcaacctgatctacggtgccggacagacggtttcgcaaccgaagctgtcg
gtcggtgacgcggtcgtgtccgaggggaactccggcacgtcgacgctcaccttcacggtg
acgatgtcgaaggcctccaccgacacggtcacggtcagctacagcaccagcaacggcagc
gcgaccgcagccggcggcgactacgtcccggcggtcgggacgctgacgttcacccccggc
cagacctcgaagacggtcgccgtcaccgtgaacggcgacacactggtcgaattcgacgaa
cagctcaccctcacgctgtccgccccggtgaacgcgaccatcgccgacggcaccggtctc
ggcacgatccgcaacgacgacgtggaccaggcgccgacgaccccgccgaccgtgtcgatc
gccgacctcaccgtgaccgagggcaacggcgaccacagccacttcatgttcgtcgccaca
ctgagcaagccgtcgacggagacggtgacggtgcggtacgcgacgtccaacggcaccgcg
accgccggtgtggactacgccgcgacgaccggcaccgtcacgttcgcgcccggtgtcacc
acacaactcgtgcacgtggacgtcctcggcgacaccgtggtcgagcagaacgagaccttc
ttcgtgacgctgacgaatcccaccggagcgaccatcggcgacggtgtcgccaccggaacc
atcaccgacgacgacacggtcgtcaccccgggcaccggcggtgtcaactccggaaacccc
ggcgacgcactgtggggcgaggccttcttcgccccctacgtggacatgggcgcctggccc
gtgcccaacctgctggctctggcgcagcagcgggggatctcgctgctcaccctgggcttc
atgcaggccacgcccgacgggaaactggcgtgggcggggttgtctgcgctgacccccgat
tcggacttcgaccaggccagggcgatcaaccagtcgatcgcggcgctgcaggccgccggc
ggcgacgtgatgatctcgctgggaggggcgtcgggcaccagcctcgcccagtggtatgcg
gcgcacggcctcggtccgcaggcgctggccgacgcgtacgccgctgtcgccgacacctac
aagctcaaccgcatcgacttcgacatcgagggttccgcggtggccgagccggcgtcgatc
gcgctgaacgcacaggcgctgcgccttcttcagcagcttcggcccgacctcgagatctgg
tacaccctgccggtgctgcccagcggtctgaccgccgacggcctcaacgtcgtgcgtaag
gcgatcgaggccggcgtgacgctcgacggcgtcaacatcatggcgatggactacggcgag
tcggcggcgcccaccagtggacccaacgcaaagaccatgggcgcctgggcgatccaggcc
gcggagtccacccacgcgcagctgagcaccctgtattcgggatacggccagaccttcgcg
tggaaccagctcggcgtgacgccgatgatcggtgtcaacgacgtgctgaccgaggtgttc
acggtggccgactcgcaggcgctggaggacttcgcccgcgcccgcggtctgggcatgctg
tcgatgtggtcgctcaaccgcgactatcccggcaacatcggtcaggtgaccacgaccacg
tccgggaccaatacgcccacaggcggtttcagcgccgtgttcaacgactacggcacggtc
aatccgatctccggtccgccgccggcgatctcgatcgccgacctcacggtggccgaaggg
aacggcgccggcgcgcacgccatgttcgtcgtcacgctcgacaagccgtccacccagacg
gtgacggtgcggtacgcgacgtcgaacggcacggcggtcgccggcaccgattacgtggcg
gccacgggcactgtcacattcgcacccggtgtgacgtcgcagacggtgcacgtcggcatc
ctcggtgacaccgtcgcggaggccgccgaaaccttctcggtgacgttgtcgaaccccacg
ggcgcgacgatcgccgacgccaccgccgtcggcgcgatcaccgacgacgacggtgtgacg
ccgacgccgggcggaaacgcgtcggtgaagtacaccgtcaacgacaactggggctccggg
ttcaccgcgtcggtcgcgctcaccgcgggggcgtccggcatgaacggctggacggtcgag
ttcgactcgccggctcagatcagcaacatctggaacgccgagatcgtcagccgggtcggc
aaccactacgtggtgcgcaacgtgtcgtacaacgcgcaggtggctgccgggcagaccatc
acgttcggcttccaggcctccccgggtggcggttcggcgacagcgaccaacttcactgtc
aacggtgcggcgaccggtcagcctgtcgtggtgccgccgaaggtgtcgatcgccgatgcc
ggtgtcgtggagtcccacagcgggacgaagaacatcgtgttcgtgctgacgttggacaaa
cccgcgacctcaccggtgagtgtggcgtatgcgacgtcgaacggaacagccaccgcgggt
ggtgatttcaccgcggcgtcgggtgtggtgaccttcgccgtgggggtgacctcccagcag
atctcggtgccggtgctcggtgacacgacggtggaggccgacgagacgttcacggtgacc
ctgtcgaatcccagtggcgtgacgatcgccgacggcagcgcgatcggcaccatcaccaac
gacgatgtggccacgcccactccgggcaatgcgtcggcctcgatggccgtgaacgacaac
tggggttcgggtttcaccgccaccgtcaccgtcaaggccggatcgtcggcgctgaacggc
tggaccgtcgagttcgacaccccggcgcagatcggcaacatctggaacgccgagatcgtc
agccgggtcggcaatcattatgtggtgcgcaacgcggcgtggaacccgaagatcgccgcg
ggccagaccgtgacattcgggttccaggcgtccccgggcggcgggtcggcgaccgcatcg
aacttcacggtcaacgggcagtcggctcccgcgcaaccgcccaccgtctcggtggccgac
gcgtcggtcggcgaatcgaactccgggacgacgcagatgacgttcgtggtcacgctgtcc
agatcgtcgaccagtccggtcaccgtcgcgtacgcgacctcgaacgggacggccacggcc
ggcgtcgactacaccgcgaagtcggggaccgtcacgttcgcgcccggcgtgttgtcacag
cagattcaggtctcggtcaccggcgacgccgcggtggaggcgaacgagaccttcaccctg
acgctgtcgaatcccgcgggcgcgacgatctcagacggctccgcgctcggcacgatcgtc
aacgatgacgtcgccgtaccgggcaacatctcgttgagcatctccgatgcctcggtgacc
gagggcgcgccgggggtcggcgtcgcgccgggctggttctccacctccggcaaccagatc
gtcgactcggcgggacgtcccgtgcagatcgccggcgtcaactggttcgggatggagagc
gaaacctttgcgccacatggcctctggacccgcaactacaaagagatgatgaacgagatg
gcggcgttggatttcaacacgatccgactcgcgtactccagcgagatgctgcacaccggc
gcggcgcccaacggcatcgacttcggaaagaacccggacctcgcgggactgtcggcgctg
cagatcatggacaagatcgtcggctacgccggcgagatcgggatgcgcgtcatcctcgac
caccaccgcagcagcaagggcgcgggcccgaacagcaacgggctctggtacgagggctcc
tacaccgaggcggcatggatcgacgactggacgatgctcgcccagcggtatgcgaacacc
ccgacggtgatcggcgcggatctgcacaacgagcctcatgccggaacctggggcggtggc
ggcgccaccgactgggccgcagccgccgaacgcgcgggcaacgctgtgctgtcggtgaat
tcgaactggctcatcttcgtcgagggggtggccgactaccaggggcattcctattggtgg
ggtggcaatctgatgggtgtcaaggatcgcccgatcgtgctgaacacgccgaaccgcgtc
gtgtactccccgcacgactatccgaactcggtgtacgcgcagccctggttccagaccgcg
aacttcggtgccgcgctaccggacaagttcgagcagatgtggggctacatctacgagcag
aagatcgccccgatctacctcggtgaattcggcacgcggctcagcgatcccaaggacgtc
atctggtacgaggccatcacgtcgtacctgtccggcgacttcgacaacgacggcaccgtc
gacatcgcggccggcaccgaggacatgtcgtggacgttctggtcgtggaaccccaattcc
cgggacaccggcggaatcctggccgacgactggaggacggtcaacacgaacaagatggcc
tacctggaagccatccagttcgatttcgacgacagcagcccgggcgtgctcgcgcagttc
gtggtgtcgctcgccgcgccctccacccaggtggtgacggtgcagtacgccacgtcgaac
cagaccgcgggtgccggcagcgattacgcgccggcgaccggcacgctgaccttccagccg
ggggagacccacaagacgatcaccgtggtcgtgttcgcagacacggtgatggagggcaac
gagacgttcctggtgacgctgtcgagcccggcgggcgcgacactggccgatggttccggc
accggcacgatcagggaccgcacgatcgtctaa

DBGET integrated database retrieval system