KEGG   Mycobacterium gilvum Spyr1: Mspyr1_24930Help
Entry
Mspyr1_24930      CDS       T01376                                 

Definition
pyridoxal-phosphate dependent TrpB-like protein
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:msp01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:msp00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:msp00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2578116..2579417
Genome map
AA seq 433 aa AA seqDB search
MTEQRGATHPDLVAAEVPTHWYNLAAELDEPIPPHLHPATKEPVGPDDLAPLFASGLIAQ
EVATDTYIEIPEPVREIYTMWRPSPLIRARRFEKALNTGARIYVKYEGVSPVGSHKTNSA
VAQAYYNSIDGVRKLTTETGAGQWGSALSFAGAQFGLEVEVWQVRASYESKPYRGHLMRT
YGGTVHSSPSTLTESGRAILAKDPDTTGSLGMAVSEAVEVAAADPEVRYALGSVLNHVVL
HQTVIGQEAVAQLALTEPDGADVVFGCAGGGSNLVGLSFPFLREKIHGRSNPRIVAAEPT
ACPSITEGEYRYDHGDVAGLTPLLKMHTLGMDFVPDPIHSGGLRYHGMAPALSHTVELGL
VEGVAISQHDAFAAGVQFARTQGIVPAPESTHAIAAATRHVADDPREQVVVIGLSGHGQL
DLPAYADFLDGKF
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacagcgtggcgccacccatccggacctcgtcgccgcggaggtgccgacccac
tggtacaacctggcggccgagctggatgagccgatcccgccgcacctgcatcccgccacc
aaggaaccggtcggcccggatgacctcgcgccgctgttcgctagcgggttgatcgcgcag
gaggtggccaccgacacctacatcgagatcccggagccggtgcgggagatctacacgatg
tggcgtccgtcgccgctgatccgggcccggcgcttcgagaaggccctgaacaccggagcc
cgtatctacgtcaagtacgagggtgtgagcccggtaggcagccacaagaccaactcggcg
gtggcgcaggcctactacaactccatcgacggtgtgcggaagctgaccaccgagaccggc
gccggccagtggggcagcgcgctgtcgttcgccggagcgcagttcggcctggaggtcgag
gtgtggcaggtccgcgcttcgtatgagtcaaagccgtatcgcgggcatttgatgcggacc
tatggcggcacggtgcattccagcccgtcgacgctcaccgagtcgggccgcgccattctg
gccaaggatccggacactaccggcagcctcggtatggcggtcagcgaggcggtcgaggtc
gccgcggccgacccggaggtccgctacgcgctgggcagcgtgctcaaccatgtggtgctg
catcagaccgtcatcggccaggaggccgtcgcgcagctggcgctgaccgagcctgatggc
gccgacgtcgtattcggttgtgctggtggcggttcgaacctcgtcgggctgtcgttcccc
ttcctgcgagagaagatccacggccggtcgaacccgcggatcgtcgccgccgagccgacc
gcgtgcccgtcgattaccgagggggagtaccgctacgatcacggtgacgtcgccggactg
actccgctgctcaagatgcacaccctcggtatggatttcgtgcccgacccgatccactcc
gggggactgcgctatcacggcatggcgccggcgctcagccacaccgtggagctcggtctg
gtggaaggcgtggcgatctcgcagcacgatgcgttcgctgccggtgtgcagttcgcgcgc
acgcagggcatcgtgccggcaccggagtcgacgcatgccatcgcggcggcgacccggcac
gtcgcggacgatccgcgagagcaggtggtcgtcatcgggctgtccggacacggccagctc
gatctgccggcgtacgcggacttcctcgacggaaagttctga

DBGET integrated database retrieval system