KEGG   Mycobacterium gilvum Spyr1: Mspyr1_24930Help
Entry
Mspyr1_24930      CDS       T01376                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mspyr1_24930
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mspyr1_24930
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mspyr1_24930
Enzymes [BR:msp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mspyr1_24930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2578116..2579417
Genome map
AA seq 433 aa AA seqDB search
MTEQRGATHPDLVAAEVPTHWYNLAAELDEPIPPHLHPATKEPVGPDDLAPLFASGLIAQ
EVATDTYIEIPEPVREIYTMWRPSPLIRARRFEKALNTGARIYVKYEGVSPVGSHKTNSA
VAQAYYNSIDGVRKLTTETGAGQWGSALSFAGAQFGLEVEVWQVRASYESKPYRGHLMRT
YGGTVHSSPSTLTESGRAILAKDPDTTGSLGMAVSEAVEVAAADPEVRYALGSVLNHVVL
HQTVIGQEAVAQLALTEPDGADVVFGCAGGGSNLVGLSFPFLREKIHGRSNPRIVAAEPT
ACPSITEGEYRYDHGDVAGLTPLLKMHTLGMDFVPDPIHSGGLRYHGMAPALSHTVELGL
VEGVAISQHDAFAAGVQFARTQGIVPAPESTHAIAAATRHVADDPREQVVVIGLSGHGQL
DLPAYADFLDGKF
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacagcgtggcgccacccatccggacctcgtcgccgcggaggtgccgacccac
tggtacaacctggcggccgagctggatgagccgatcccgccgcacctgcatcccgccacc
aaggaaccggtcggcccggatgacctcgcgccgctgttcgctagcgggttgatcgcgcag
gaggtggccaccgacacctacatcgagatcccggagccggtgcgggagatctacacgatg
tggcgtccgtcgccgctgatccgggcccggcgcttcgagaaggccctgaacaccggagcc
cgtatctacgtcaagtacgagggtgtgagcccggtaggcagccacaagaccaactcggcg
gtggcgcaggcctactacaactccatcgacggtgtgcggaagctgaccaccgagaccggc
gccggccagtggggcagcgcgctgtcgttcgccggagcgcagttcggcctggaggtcgag
gtgtggcaggtccgcgcttcgtatgagtcaaagccgtatcgcgggcatttgatgcggacc
tatggcggcacggtgcattccagcccgtcgacgctcaccgagtcgggccgcgccattctg
gccaaggatccggacactaccggcagcctcggtatggcggtcagcgaggcggtcgaggtc
gccgcggccgacccggaggtccgctacgcgctgggcagcgtgctcaaccatgtggtgctg
catcagaccgtcatcggccaggaggccgtcgcgcagctggcgctgaccgagcctgatggc
gccgacgtcgtattcggttgtgctggtggcggttcgaacctcgtcgggctgtcgttcccc
ttcctgcgagagaagatccacggccggtcgaacccgcggatcgtcgccgccgagccgacc
gcgtgcccgtcgattaccgagggggagtaccgctacgatcacggtgacgtcgccggactg
actccgctgctcaagatgcacaccctcggtatggatttcgtgcccgacccgatccactcc
gggggactgcgctatcacggcatggcgccggcgctcagccacaccgtggagctcggtctg
gtggaaggcgtggcgatctcgcagcacgatgcgttcgctgccggtgtgcagttcgcgcgc
acgcagggcatcgtgccggcaccggagtcgacgcatgccatcgcggcggcgacccggcac
gtcgcggacgatccgcgagagcaggtggtcgtcatcgggctgtccggacacggccagctc
gatctgccggcgtacgcggacttcctcgacggaaagttctga

DBGET integrated database retrieval system