KEGG   Mycobacterium gilvum Spyr1: Mspyr1_25880Help
Entry
Mspyr1_25880      CDS       T01376                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mspyr1_25880
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mspyr1_25880
Enzymes [BR:msp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mspyr1_25880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2662114..2664402
Genome map
AA seq 762 aa AA seqDB search
MAITEADLQSQTPFERDVVETQRYFDSPRFEGIIRLYTARQVAEQRGTIPADYPVAREAA
TAFFPHLRELFGQGRSITTFGPYSPGQAVVMKRMGIEGIYLGGWATSAKGSISEDPGPDL
ASYPLSQVPEEAAGIVRALLTADRNQQYLRLQMTPEQQATTPAYDYRPFIIADADTGHGG
DPHVRNLIRRFVENGVPGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNTARFQLDIMR
VPGIIVARTDAEAANLIDSRADERDQPFLLGATNLKIPSYKSCYLAMMRRFYDKGVTELN
GHLLYALPDGEYATAEAWLQRQGVLDLVDQTAAAWQDGTEASLDTAFDKVESRFVEAWQD
DAGLNTYGEAVAELLEFREREGEPSPMSVAQWREFAERAPLYTAREKAKELGADVAWDCE
RVKTPEGYYQVRGGIPYAIAKSLAAAPFADILWMETKTADLADAKQFADAIHAVYPDKML
AYNLSPSFNWDTTGMTDEEMRAFPEEIGKMGFVFNFITYGGHQVDGVASEEFATSLRQEG
MLALARLQRKMRLVESPYRTPQTLVGGPRSDAALAASSGRTATTKSMGKGSTQHQHLVQT
EVPKKLLEEWLALWSEHNKLPERLHVQLRPRRAGSDVLDLQILGDSEDPLANVVVDPIKD
RHGRSILTVRDQNTFAEHLRQKRLMDVIHLWLIHRFKAEIVYYVTPTEDNIYQTEKMKSH
GIFSDVYQEVGEIIVADVNQARIDELLAPDREALTRLITKQD
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggccatcaccgaagctgacctccagtcgcagactccgttcgagcgtgacgtcgtcgag
acgcagcgctatttcgacagcccccggttcgagggcatcatccgcctctacacggcccgt
caggtcgccgaacagcgcggcaccatccccgcggactatccggtcgcccgcgaggcggcg
accgcgttcttcccccacctgcgggagctgttcggccagggccgcagcatcaccacgttc
gggccgtactcccccggtcaggccgtggtgatgaagcggatgggcatcgagggtatctat
ctgggcggctgggcgacgtcggcgaaggggtccatcagcgaagatcccggccccgacctc
gccagctatccgctgagccaggtaccggaggaggccgccggcatcgtgcgcgcgctgctg
accgccgaccgcaaccagcagtacctgcggctgcagatgaccccggaacagcaagcgacc
acgcccgcctacgactaccggccgttcatcatcgccgacgccgacaccggacacggcgga
gatcctcacgtacgcaacctgattcgacgcttcgtcgagaacggggtgcccggataccac
atcgaggaccagcgccccggtacgaagaagtgcggtcaccagggcggcaaggtgctggtg
ccgtccgacgaacagatcaagcggctcaacaccgcccgcttccaactcgacatcatgcgg
gtgcccggcatcatcgtggcccgcaccgatgccgaggcggccaacctgatcgacagtcgc
gccgacgaacgggaccagcccttcctgctcggagccaccaacctgaagatcccgtcgtac
aaatcgtgctacctggcgatgatgcggcggttctacgacaagggcgtcaccgagctcaac
gggcacctcctctacgcgctgcccgacggggagtacgccaccgccgaggcgtggctgcag
cgccagggcgtgctcgatctggtcgaccagaccgcggcggcatggcaggacggtaccgaa
gcctcgctcgacaccgccttcgacaaggtcgagtcgaggttcgtcgaagcatggcaggac
gacgccggtctgaacacctacggcgaagccgtcgccgaactgctggagttccgcgaacgt
gagggcgaaccgtcgccgatgagcgtcgcgcagtggcgggagttcgccgagcgggcgccg
ctgtacaccgcgcgggagaaggccaaggagctcggcgccgacgtcgcgtgggactgcgag
cgggtcaagacccctgagggctactaccaggttcgcggcggcatcccgtacgcgatcgcg
aagtctctggccgccgcaccgttcgccgacatcctgtggatggagaccaagaccgccgac
ctcgccgacgccaagcagttcgccgacgcgatccacgccgtctatccggacaagatgctg
gcctacaacctgtcgccgtcgttcaactgggacaccaccgggatgaccgacgaggagatg
cgggccttccccgaggagatcggcaagatggggttcgtcttcaacttcatcacctacggc
ggacaccaggtcgacggtgtggcgtccgaggagttcgcgacctcgttgcgccaggagggc
atgctcgcgttggcccggttgcagcgcaagatgcgactcgtcgaatctccttaccgcaca
ccgcaaacactggtcggtggaccccgcagcgatgcggctctggccgcgtcgtcgggtcgg
accgcgacgacgaaatcgatgggcaagggctcgacccagcatcagcacctcgtgcagacc
gaagtgcccaagaaactgttggaagaatggctggccctgtggagcgagcacaacaagctc
ccggagcggctgcacgtccagctgcgtccccgccgcgccgggtcggacgtgctggacctg
cagatcctgggcgattccgaggacccgctggccaacgtggtcgtcgaccccatcaaggac
cgtcacggccgcagcatcctgaccgtccgtgatcagaacaccttcgccgagcacctccgg
cagaagcggctcatggatgtcatccatctgtggctgatccaccggttcaaggccgagatc
gtctactacgtgacgccgaccgaggacaacatctatcagacggagaagatgaagtcgcac
ggcatcttcagcgatgtctaccaggaggtcggcgagatcatcgtcgccgacgtgaaccag
gctcggatcgacgaactcctcgcccccgaccgggaggcgttgacgcgcttgatcaccaag
caggactga

DBGET integrated database retrieval system