KEGG   Mycobacterium gilvum Spyr1: Mspyr1_26310Help
Entry
Mspyr1_26310      CDS       T01376                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:msp00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2700774..2701796
Genome map
AA seq 340 aa AA seqDB search
MAEQLELAYAGMASFGHRPFLTEVEQLDSWRPDAAIVGAPFDVGTTNRPGARFGPRAIRA
TAYEPGTYHMDLGLEIFDWLEVVDFGDAYCPHGQTEVSHNNIRERVHMLASRGIVPVVLG
GDHSITWPAATAVADVHGYGNVGIVHFDAHADTADEIEGNLASHGTPMRRLIESGAVPGS
HFVQVGLRGYWPPRDTFDWMLEQKMTWHTMQEIWERGFKAVMADAVGEALAKADKLYVSV
DIDVLDPAHAPGTGTPEPGGITSADLLRMVRQLCYEHDVAGVDVVEVAPAYDHAELTVNA
AHRVVFEALAGMAARCRDAANGEVGQPARSYRDRDATSRE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacaactggagctggcgtacgccgggatggcgtccttcgggcatcgcccgttc
ctgaccgaggtcgagcagctcgactcctggaggcccgacgcggcgatcgtcggcgcaccg
ttcgacgtggggaccaccaacagacccggcgcgcgcttcgggcccagggccatccgcgcc
accgcctatgagcccggcacctatcacatggacctcgggctggagatcttcgactggctc
gaggtcgtcgacttcggtgacgcctactgcccacacggccagaccgaggtgtcgcacaac
aacattcgcgaacgcgtgcacatgctcgcctcccgcggcatcgtgcccgtggtgctcggc
ggcgaccactccatcacctggcccgcggcgaccgcggtcgccgacgtccacggctacggc
aacgtcggcatcgtgcacttcgacgcccacgccgacaccgccgacgagatcgagggcaac
ctcgccagccacggcactccgatgcgccggctgatcgagtccggtgcggtgcccgggtca
catttcgttcaggtcggcctacgcggctactggccgccccgcgacacgttcgactggatg
ctcgagcagaagatgacctggcacacgatgcaggagatctgggagcgagggttcaaggcg
gtgatggccgacgcggtcggcgaggccctggccaaggccgacaaactctacgtctccgtg
gacatcgacgtgctcgatcccgcgcacgcaccgggcacgggaacgccggagccgggcggc
atcaccagcgccgacctgctgcgcatggtgcggcaactctgctacgaacacgacgtcgcc
ggcgtggacgtcgtcgaggtggcaccggcctacgaccacgccgagctcacggtcaacgcc
gcgcaccgggtggtgttcgaggcactcgccggcatggcggcgcgatgccgggacgccgcg
aacggcgaggtgggccaaccggcgcggtcctaccgggaccgggacgctacttcgcgagag
tga

DBGET integrated database retrieval system