KEGG   Mycobacterium gilvum Spyr1: Mspyr1_26980Help
Entry
Mspyr1_26980      CDS       T01376                                 

Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mspyr1_26980
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mspyr1_26980
   00630 Glyoxylate and dicarboxylate metabolism
    Mspyr1_26980
Enzymes [BR:msp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Mspyr1_26980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2766460..2768676
Genome map
AA seq 738 aa AA seqDB search
MTDRVTVGNLRVSPVLYDFINNEALPGTDIDPDTFWSGVDKIVADLTPKNQDLLARRDHL
QAQIDKWHRARVIGGFEAEDYKQFLTEIGYLEPEPADFSVTTSGVDDEITTTAGPQLVVP
ILNARFALNAANARWGSLYDALYGTDVISDEDGAEAGSSYNKRRGDKVIAYARRFLDGAA
PLASGSWTDITGLRIDDGAVSATLDDGGSVALADPQQFVGYHGEPDAPTAVLLANNGLHI
EILIDADSPIGSTDKAGIKDVVLESAITTIMDFEDSVAAVDADDKVLGYRNWLGLNRGDL
AEEVSKGGKTFTRVLNSDRTYRAPDGETELTLPGRSLLFVRNVGHLMTNDAIVVDDNGAD
GAEVPEGIQDALFTSLIGIHGLRSAGDDDTKNGPLLNSRTGSIYIVKPKMHGPDEVAFTC
ELFSRVEDVLGLPQNTIKVGIMDEERRTTLNLKACIKAAADRVVFINTGFLDRTGDEIHT
SMEAGPMIRKGAMKSTDWIAAYENQNVDIGLETGLSGKAQIGKGMWAMTDLMADMVEQKI
GQPKAGATTAWVPSPTAATLHAMHYHQVDVFAVQSELAGKRRSTLDELLTIPLATELAWA
PEEIREEVDNNCQSILGYVVRWIDAGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRH
GVITEEDVKTSLRRMAAVVDEQNAADPDFRPMASDPDNSIAFQAAQELILDGAAQPSGYT
EPILHRRRREYKAASNVG
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgacggatcgcgtgacggtgggcaacctgcgcgtctctcccgtgttgtacgacttcatc
aacaacgaggcgttgccgggtaccgacatcgaccccgacacgttctggtccggggtcgac
aagatcgtcgccgacctgacgcccaagaaccaggacctgctcgcccggcgcgaccatctg
caggcccagatcgacaagtggcaccgcgcgcgggtgatcggcggattcgaggccgaggac
tacaagcagttcctcaccgagatcggctacctggaacccgagcccgccgacttctccgtc
accacctccggcgtcgacgacgagatcaccaccaccgcgggcccgcagctcgtcgtgccg
atcctcaacgcccgcttcgcactcaacgccgccaacgcccgttggggttcgctctatgac
gccctctacggcaccgacgtcatctccgacgaggacggcgccgaggcgggcagctcgtac
aacaagcggcgcggcgacaaggtcatcgcctacgcgcgcaggttcctcgacggcgcggcc
ccactggcgtccggatcgtggacggacatcaccggccttcgcatcgacgacggggcggtg
agcgcgacgctcgacgacggcggctcggtcgcgctggccgacccgcagcagttcgtcggc
taccacggcgaacccgacgcgccgaccgcggtgctgctggccaacaacggcctgcacatc
gagatcctgatcgatgccgactcccccatcggctccaccgacaaggccggcatcaaggac
gtcgtgctggagtccgccatcaccacgatcatggacttcgaggactccgtggcggccgtc
gacgccgacgacaaggtgctgggctaccggaactggttggggctcaaccgcggtgacctc
gccgaagaggtcagcaagggcggcaagacgttcacccgggtgctcaactccgaccgcacc
taccgtgctcccgacggcgagaccgagctcactctgcccggccggagcctgctgttcgtg
cgcaacgtgggtcacctgatgaccaacgacgcgatcgtggtcgacgacaacggtgccgac
ggcgccgaggtccccgagggcatccaggacgcgctgttcaccagcctcatcggcatccac
ggtctgcggtccgccggcgacgacgacaccaagaacggcccgttgctcaacagccgaacc
gggtcgatctacatcgtgaagcccaagatgcacggacccgacgaggtcgcgttcacctgt
gagctgttcagccgcgtcgaggacgtcctcggtctgccgcagaacaccatcaaggtcggc
atcatggacgaagagcgccgcacgacgctgaacctgaaggcgtgcatcaaggccgccgcc
gaccgcgtcgtgttcatcaacaccggattcctcgaccgcacgggcgatgagatccacacg
tcgatggaagcgggcccgatgatccgcaagggcgcgatgaagtcgaccgactggatcgcc
gcctacgagaatcagaacgtcgacatcggcctggagaccgggctgtccggtaaggcccag
atcggcaagggcatgtgggccatgaccgacctgatggccgacatggtcgagcagaagatc
ggccagcccaaggccggcgccaccaccgcgtgggtgccctcgccgaccgcggccaccctg
cacgcgatgcactaccaccaggtcgatgtgttcgcggtgcagtcggaactcgccggcaag
cgccgctcgaccctcgacgaactcctgaccatcccgctggccacggaactggcctgggcg
ccggaggagatccgcgaggaggtcgacaacaactgccagtcgatcctcggctacgtcgtg
cgctggatcgacgcgggtgtcggctgctcgaaggtgcccgacatccacgacgtcgcgttg
atggaagaccgtgcgacactgcgtatctcgagtcagctgctggccaactggctgcgccac
ggcgtgatcaccgaagaggacgtcaagaccagcctgcggcgcatggcggccgtggtcgac
gagcagaacgccgcggaccccgacttccggccgatggcatccgatcccgacaacagcatc
gcgttccaggcggcccaggaactgatcctcgacggcgcggcgcagcccagcggctacacc
gagccgatcctgcaccgcaggcgccgggagtacaaggcagctagtaacgttggctga

DBGET integrated database retrieval system