KEGG   Mycobacterium gilvum Spyr1: Mspyr1_27530Help
Entry
Mspyr1_27530      CDS       T01376                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mspyr1_27530
Enzymes [BR:msp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Mspyr1_27530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2851676..2853829
Genome map
AA seq 717 aa AA seqDB search
MTVDPEVLEVSPSLTELAARYGVATEYTDWTGGSVRVSASTLIGVLDALGVPATTERERE
AALAEHDRGYWGRALPATVVGRAGAATPFWVHVTHGDPARLWLRLEDGSVRTGLRQLENN
RPPFDLDGRLVGEASFELPPDLPIGYHRLHLQIGSLDVSTAVIVAPASLPERPVGRTWGL
STQLYSVRSRRSWGTGDLTDLADIAVWSAARHGAGFVLVNPMHAASPVAPMEPSPYLPTS
RRFVNPLYLRVEAVPEYAYVRHRSRIRKAQTQVQARAARSGQIERDRAWKAKRAALETVY
LVERSPGREIAYRAFRQRQGRSLDDFATWCVLAEKHGADWHQWPEELRHPRTEAVSAFAQ
KHSKDIDFHCWLQWLVDEQLSAAQDSAVRAGMDLGIMHDLAVGVDPDGADAWALQDVLAL
GVTAGAPPDEFNQLGQDWSQPPWRPDRLAEAAYEPFRALVNAVLRHAGGVRIDHIIGLFR
LWWIPKGALPLEGTYVRYDHEAMIGIVALEAHRAGAVVVGEDLGTVEPWVRDHLRDRGLF
GTSILWFEMTEEGRQPLPAERWREFCLSAVTTHDLPPTAGYLAGEHVRLRDELGLLTRPA
EEELAGDREHQQAWRAELRRVGLLGGDAESEADVDETVLALHRYLGLTPSRLLALSLADA
VGEVRTQNQPGTTDEYPNWRVPLAGPDGRQVLLDDIFDDPRAAALCEAMRAAVTPPA
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttgaccccgaggtgctcgaggtgtccccgtccctgaccgaactcgcggcgcgg
tacggggtcgcgaccgagtacacggactggaccggcgggtccgtacgggtgtcggcgtcc
acgctgatcggggtgctcgacgcgctcggcgtgcccgccaccactgagcgcgagcgcgaa
gccgccctggccgagcacgaccgcggctactggggccgcgcgctgccggcgacggtggtg
gggcgcgcgggtgcggccacaccgttctgggtgcatgtcacccacggcgacccggcccgg
ttgtggctgaggctcgaagacggcagcgtccgtaccggtctgcgacaactcgaaaacaac
aggccgccattcgatctcgatggtcggctcgtgggcgaggcgtcgttcgagcttcccccc
gacctgccgatcggctaccaccggctgcacctgcagatcggctcgctggacgtgagcacg
gcggtgatcgttgcgcccgcctcgctcccggagcgcccggtgggccgcacctgggggctg
tccacccagttgtacagcgtgcggtcccggcggtcctggggcacaggcgatctgaccgac
ctcgccgatatcgcggtgtggtcggcagcgcgtcacggcgcgggcttcgtgctggtgaac
ccgatgcatgccgcctcaccggtggcgccgatggagccctcgccctacctgccgacgtca
cgccggttcgtcaatccgctgtatctgcgggtggaggcggtgcccgaatacgcctacgtg
cgccaccgcagccggatccgcaaggctcagacgcaggtgcaggcgcgcgccgcccgctcc
gggcagatcgagcgcgaccgcgcgtggaaggccaagcgtgccgcgctggagacggtgtat
ctcgtggagcgttcgccggggcgggagatcgcctatcgggcgttccggcaacggcagggc
cgcagtctcgatgatttcgcgacgtggtgtgtgctggccgagaaacacggtgccgactgg
catcagtggcccgaggaactgcgacacccgcgcaccgaggcggtgtcggcgttcgcccaa
aagcattccaaggacatcgatttccactgctggctgcaatggctggtcgacgaacagctc
tcggccgcccaggactccgcggtgcgggcaggcatggatctgggcatcatgcacgacctc
gccgtgggagtggatcccgacggcgcggacgcgtgggccctgcaggacgtgctcgctctc
ggtgtcaccgcgggcgctcccccggacgagttcaaccagctcggtcaggattggtcgcag
ccgccgtggcggcccgaccgtctcgcggaggcggcatacgaaccgttccgtgcgctggtc
aacgctgtgctgcggcatgccggtggggtgcggatcgaccacatcatcgggttgttccgg
ctgtggtggatcccgaagggtgcactgccgctggaaggtacgtacgtgcggtacgaccat
gaggcgatgatcggcatcgtcgcgttggaggcccaccgggccggcgcggtcgtcgtcggc
gaggacctcgggacggtcgagccgtgggtgcgtgaccatctgcgtgatcgcggtctcttc
ggcacgtcgatcctgtggttcgagatgaccgaggagggacggcagcccctgccggcggaa
cgctggagggagttctgcctgtcggcggtgacgacacacgacctgccgcccaccgcgggt
tatctggccggcgaacatgtccggctgcgcgacgagctgggcctgctgacccgccccgcc
gaggaggagctggccggcgaccgggagcaccagcaggcctggagggcggagttgcggcga
gtcgggctgctcggcggcgatgccgagtcggaggccgacgtcgacgagacggtgctggcg
ctgcaccgctacctgggattgacgccgtcgcggctgctggcgctctcgctggccgacgcg
gtcggcgaggtgcgcacccagaatcagccgggtacgaccgacgagtacccgaactggcgg
gtgccgctcgccgggccggacggccggcaggtgctgctcgacgacatcttcgacgacccg
cgcgcggcggccctctgtgaggcgatgcgcgccgcggtgacgccacccgcctga

DBGET integrated database retrieval system