KEGG   Mycobacterium gilvum Spyr1: Mspyr1_28380Help
Entry
Mspyr1_28380      CDS       T01376                                 

Definition
O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:msp00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2942493..2943230
Genome map
AA seq 245 aa AA seqDB search
MNALRRWARLALGMRSFVRTGQMGDGRESACADHVETHAAPGDIDAALSAIDGFAVREAV
LVNVGVEKGALLDAAVRRADPALALELGTYCGYSALRIARAAPSARVLSVEFSAANAEVA
RRIWTHAGVADRVTCVVGTLGDGGRTLDSLAGEHGVGPGSVDLLFIDHDNSAYLSDLLSI
EQRGWLHRGSLVVADNVRIPGAPEYRRYMREHEGTRWHTVEHKTHVEYQSLLPDLVLESE
YLVGS
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccttcggcggtgggcgcggctggcgctcggcatgcggtcgttcgtgcgcacc
ggccagatgggcgacggcagggagagcgcgtgcgccgaccacgtcgagacccacgccgca
cccggcgacatcgacgcagcgctctcggcgatcgacgggttcgccgtccgggaggccgtg
ctggtcaatgtcggtgtcgaaaaaggtgcgctgctcgacgccgcggtgcgtcgggcggac
ccggccctggctctggaactgggcacctactgcgggtacagcgccctgcggatcgcccgg
gccgctccgtctgcacgggtgctctccgtcgagttctccgccgccaacgccgaggtcgcg
cgacggatctggacccacgccggggtggccgaccgcgtcacctgcgtcgtcggcacgctc
ggagacggcgggcgcaccctcgacagcctcgccggagaacacggcgtcggccccggcagc
gtcgacctgctgttcatcgaccacgacaacagcgcctacctgtccgatctgctgagcatc
gagcagcgcggctggctgcaccgcgggtcactcgtggtcgccgacaacgtgcggatcccc
ggcgccccggagtaccggcgctacatgcgcgagcacgagggcacccgctggcacaccgtc
gagcacaagacgcacgtcgagtaccagtcgttgctcccggacctggtgctggagtcggag
tacctggtcggcagttag

DBGET integrated database retrieval system