KEGG   Mycobacterium gilvum Spyr1: Mspyr1_29420Help
Entry
Mspyr1_29420      CDS       T01376                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mspyr1_29420
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mspyr1_29420
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mspyr1_29420
Enzymes [BR:msp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mspyr1_29420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3057875..3058663)
Genome map
AA seq 262 aa AA seqDB search
MSRLAGLFDSCRAEGRSALIGYLPTGFPDVDTSIQAMVALVESGCDIVEVGVAYSDPGMD
GPVIAAATEVALRGGVRVHDAFRAVEAISNAGGKAVVMTYWNPVLRKGVDTFARDLASAG
GLGLITPDLIPDEADDWFAASEAHDLDRIFLVAPSSTPERLAETVQASRGFVYAASTMGV
TGARDAVSNAAPELVARVKAISDIPVGVGLGVRSREQAAEIGAYADGVIVGSALVSALKE
GIPAVRSLTAELADGVRQRITA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagccggctggccgggctgttcgactcctgccgtgccgagggccgttcggcgctgatc
ggctatctgcccaccgggtttccggatgtcgacacgtcgatccaggcgatggtcgcgctg
gtcgagtctggctgcgacatcgtcgaggtgggtgtcgcgtactcggaccccggcatggac
ggcccggtcatcgcggcggcgaccgaagtggcgttgcggggcggcgtccgggtgcacgac
gcgttccgcgcggtcgaggcgatcagcaatgccggcggcaaggcggtcgtgatgacgtac
tggaatccggtgttgcgcaagggagtcgacacgttcgcccgtgacctggcgtcggcgggc
gggctcgggttgatcacgccggacctgatccccgacgaggccgacgattggttcgccgcc
tccgaagcacacgatctggatcggatcttcctggtggccccgtcgtcgacgccggagcgt
ctcgccgagacggtgcaggcgtcccgcggattcgtctacgcggcgtccacgatgggcgtc
accggcgcacgcgacgcggtgtccaacgctgcgccggagctcgtcgcgcgcgtgaaggcc
atctcggacatcccggtcggtgtggggctgggcgtgcggtcccgtgagcaggcagcggag
atcggcgcctacgccgacggcgtcatcgtcggatcggcactggtgtcggcgctcaaggag
ggcatccccgcggtgcgctcgctgacagcggaacttgcagacggcgtacggcagaggatc
actgcgtga

DBGET integrated database retrieval system