KEGG   Mycobacterium gilvum Spyr1: Mspyr1_30500Help
Entry
Mspyr1_30500      CDS       T01376                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mspyr1_30500
   01230 Biosynthesis of amino acids
    Mspyr1_30500
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mspyr1_30500
   00051 Fructose and mannose metabolism
    Mspyr1_30500
   00562 Inositol phosphate metabolism
    Mspyr1_30500
Enzymes [BR:msp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mspyr1_30500
Exosome [BR:msp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mspyr1_30500
  Exosomal proteins of bladder cancer cells
   Mspyr1_30500
  Exosomal proteins of melanoma cells
   Mspyr1_30500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3170489..3171274)
Genome map
AA seq 261 aa AA seqDB search
MTRKPLIAGNWKMNLNHFEAIALVQKIAFSLPDKYFDRVDVTVIPPFTDLRSVQTLVDGD
KLRLTYGAQDVSQHDSGAYTGEISGAFLAKLGCTFAVVGHSERRTYHGETDELVAAKATA
ALKHGLTPIVCIGEQLEVREAGNHVEFNVNSLRGSLAGLSAEQIAQTVIAYEPVWAIGTG
RVASAADAQEVCKAVRDELGNLASADVAAGVRVLYGGSVNAKNVGEIVGQGDVDGALVGG
ASLDGEQFATLSAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ttgacccgtaagccgctgatcgccggcaactggaagatgaacctgaaccacttcgaggcg
atcgctctggttcagaaaatcgcattctcgttgccggacaagtacttcgaccgggtcgac
gtcacggtcatcccaccgttcaccgatctgcgcagcgtgcagacgctcgtcgacggcgac
aagctgcgactcacctacggcgcccaggacgtgtcccagcacgattcgggcgcctacacc
ggcgagatcagcggcgcgttcctggccaagctgggctgcacgttcgccgtcgtcgggcac
tccgaacgccgcacctaccacggtgagaccgacgagctggtcgccgcgaaggccactgcg
gcgctcaagcacggtctgaccccgatcgtgtgcatcggcgaacaactcgaggtgcgcgag
gccggcaaccacgtcgagttcaacgtgaactcgctgcgcggctcgctggccgggctctcc
gccgagcagatcgcccagacggtcatcgcctacgagccggtgtgggcgatcggcaccggc
cgggtggccagtgccgccgacgcgcaggaagtgtgcaaggccgtccgcgacgaattgggc
aacctcgcgtcggccgacgtcgccgcaggtgtccgggttctctacggcggatcggtcaac
gccaagaacgtcggcgagatcgtcggccagggcgacgtcgacggcgcactggtcggcggg
gcgtcgctggacggtgagcagttcgccacgttgtcggcgatcgccgcgggcggcccactg
ccctga

DBGET integrated database retrieval system