KEGG   Mycobacterium gilvum Spyr1: Mspyr1_30810Help
Entry
Mspyr1_30810      CDS       T01376                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
msp00230  Purine metabolism
msp01100  Metabolic pathways
Module
msp_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mspyr1_30810
Enzymes [BR:msp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Mspyr1_30810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 AAA_33 CPT AAA_22 MMR_HSR1 RsgA_GTPase Cytidylate_kin AAA_29 Rad17
Motif
Other DBs
NCBI-ProteinID: ADT99698
UniProt: E6TCD1
Position
complement(3205232..3205843)
Genome map
AA seq 203 aa AA seqDB search
MSEGRGPDSASGATVLVLSGPSAVGKSTVVRCLRERVADLYFSVSVTTRAPRPGEVDGVD
YFFVTPERFQQLIDDNALLEWADIHGGLHRSGTPAAPVREAAAAGRPVLIEVDLAGARAV
KKAMPEATSVFLAPPSWETLESRLIGRGTETPEVIARRLETARAELAAQDDFDEIVVNSQ
LESACAELVALLVAHAPERRDQP
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaaggtagggggccggacagcgcatccggggccacggtcctggtgttgtccggc
ccatctgccgtcgggaagtccaccgtcgtgcgctgcctgcgggagcgcgtcgccgatctg
tacttcagcgtgtcggtgacgacgcgggctccgcggcccggcgaggtcgacggggtggac
tatttcttcgtgaccccagagcggtttcagcagctcatcgacgacaatgccctgctcgaa
tgggcggacatccacggaggcctgcaccgctccgggacgcccgcagcccccgtgcgcgag
gcagctgcggccggccgcccggtactgatcgaagtcgacctcgccggcgcccgcgcggtc
aagaaggcgatgcccgaggcgacgtcggtcttcctcgcaccgccgagctgggagacgctg
gagagccgattgatcggccgcggcaccgagacacccgaggtgatcgcccgccggctggag
accgcccgggcggaactggcggctcaggacgacttcgacgagatcgtcgtcaacagtcaa
ttggagtctgcctgcgcggaattggtagccttgctggtggcccacgcgccggaacgacgc
gatcagccctaa

DBGET integrated database retrieval system