KEGG   Mycobacterium gilvum Spyr1: Mspyr1_31670Help
Entry
Mspyr1_31670      CDS       T01376                                 

Definition
Holliday junction DNA helicase, Ruvsubunit alpha
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:msp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mspyr1_31670
Enzymes [BR:msp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Mspyr1_31670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3301851..3302438)
Genome map
AA seq 195 aa AA seqDB search
MIASVRGEVLDIALDHVVIEAAGVGYKVMATPATLATLRRGSEARLITAMIVREDSQTLY
GFADSDARDLFLTLLGVSGIGPSIALGALAMYDGPTLRQAIGDGDLTALTRIPKVGKKTA
ELLALTLRDKVGSSTSSGVAAAGGHGIRGPVVEALVGLGFAVKQAEEATDKVLANDPEAT
TSSALRAALSMLGKK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcgtcggtgcgcggcgaggtcctcgacatcgcgctcgaccacgtcgtcatcgaa
gccgcgggcgtgggatacaaggtcatggcgacgccggcgacactcgcgacgttgcgccgc
ggctccgaggccaggctgatcaccgcgatgatcgtgcgcgaggactcccagacgctctac
gggttcgccgactccgacgcccgcgatctgttcctcacgctgctcggggtctcgggtatc
ggccccagcatcgcgctcggtgccctggcgatgtacgacgggccgacgctgcggcaggcc
atcggcgacggtgatctgaccgcgttgacgcgaatcccgaaggtgggcaagaagaccgcc
gagctgctggcgctcaccctgcgtgacaaggtcgggtcctcgacgtcctcgggcgtcgcc
gctgcaggcgggcacggcatccggggcccggtggtcgaggcgctcgtcggtctgggcttc
gcggtcaagcaggccgaggaggccaccgacaaggtgctggccaacgacccggaggcgacg
acgtcgagcgccctgcgcgccgcgctgtcgatgctggggaagaagtag

DBGET integrated database retrieval system