KEGG   Mycobacterium gilvum Spyr1: Mspyr1_32830Help
Entry
Mspyr1_32830      CDS       T01376                                 

Definition
polyphosphate glucokinase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mspyr1_32830
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mspyr1_32830
   00520 Amino sugar and nucleotide sugar metabolism
    Mspyr1_32830
Enzymes [BR:msp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Mspyr1_32830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3407252..3408055
Genome map
AA seq 267 aa AA seqDB search
MTADAEPSSSVPQRRGFGIDVGGSGVKGGIVDLDTGVLIGERFKLLTPQPATPEAVAKTI
ADVVAHFEWTGPLGVTYPGVVADGIVRTAANVDKAWIGLNAKEVISAALGGQSVTVLNDA
DAAGLAEEKFGAGRNNTGVIVLLTFGTGIGSAVIHNGVLLPNTEFGHLEVGGKEAEHRAA
SSVKERKEWTYERWTVEVTKVLVAIENAIWPDLFIAGGGISRKAAKWIPLLKNRVPVVAA
ELQNTAGIVGAAMAAESDVTATGREHH
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgacgccgagccatcgagctccgtgccccagcgccgcggtttcggcatcgac
gtgggcggcagcggtgtcaaaggcgggatcgtcgacctcgacaccggtgtgttgatcggt
gagcggttcaagctgctgaccccgcagcccgccacgcccgaggccgtcgccaagaccatc
gccgacgtcgtcgcccacttcgagtggacgggtcccctcggcgtcacctaccccggcgtc
gtcgccgacgggatcgtgcgcacggccgccaacgtcgacaaggcctggatcgggctgaac
gccaaggaggtcatctccgccgccctcggcggccagtcggtgaccgtgctcaacgacgcc
gacgccgcgggactcgccgaggagaagttcggcgccggacgcaacaacaccggcgtgatc
gtgttgctgaccttcgggacgggaatcggctcggcggtgatccacaacggagtgctgctg
cccaacaccgagttcggacacctcgaagtcggcggcaaagaggccgagcaccgcgccgcc
agctcggtgaaggaacgcaaggaatggacctacgagcgctggaccgtggaggtcacgaaa
gtgctggtggccatcgagaacgcgatctggccggacctgttcatcgccggcggcggcatc
agccgcaaggccgccaagtggatcccgctgctgaagaaccgggtgcccgtcgtcgccgcc
gaattgcagaacaccgcgggcatcgtcggcgccgcgatggccgctgagtccgacgtcacg
gccaccggcagagaacaccactga

DBGET integrated database retrieval system