KEGG   Mycobacterium gilvum Spyr1: Mspyr1_33300Help
Entry
Mspyr1_33300      CDS       T01376                                 

Definition
limonene-1,2-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mspyr1_33300
Enzymes [BR:msp01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     Mspyr1_33300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3451805..3452260
Genome map
AA seq 151 aa AA seqDB search
MTDQADPTALTAMTDKADIVQRFLFALEVNDFDTFEELAAPGLVWQNVGLPSLRGRSTIL
KTLRRAEGKFGFAVKFHRIAADEGDTVLTERTDAIILGPLRLQFWVCGRFDINDAGQITL
WRDYFDLFDFLVKAPLRALPGILVPSLRPKF
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcaggcagatcccaccgccctcaccgcgatgaccgacaaagccgacatcgtc
cagaggttcctgttcgccctcgaggtcaacgacttcgacaccttcgaggaactcgccgcc
ccagggctggtctggcagaacgtcgggctgccgtcactgcggggccgatcgaccatcctg
aagacgctccggcgagccgaagggaagttcggtttcgcggtgaagttccaccgcatcgcc
gccgatgagggcgacaccgtcctgaccgagcgcaccgacgcgatcatcctcggtccgctg
cgccttcagttctgggtgtgcggccggttcgacatcaacgatgccggccagatcacgctg
tggcgcgactacttcgacctcttcgacttcctggtgaaggctccactgcgggcactgccc
ggaatcctggtgccgtcgctgcgcccgaagttctag

DBGET integrated database retrieval system