KEGG   Mycobacterium gilvum Spyr1: Mspyr1_33500Help
Entry
Mspyr1_33500      CDS       T01376                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mspyr1_33500
   00670 One carbon pool by folate
    Mspyr1_33500
Enzymes [BR:msp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Mspyr1_33500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3471432..3471914)
Genome map
AA seq 160 aa AA seqDB search
MTELNLIWAQSSSGVIGRDGGIPWHVPEDMARFKELTMGHTVIMGRQTWESLPEKFRPLP
GRRNVVLTRQADYVAEGAEVVTALEDAPLDDAWVIGGSQVYGLALPLATRCEITEVDLDL
HRQDEDALAPLLDEAWVGTEGEWRDSASGLRYRFYSYVRK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactgaacctgatctgggcgcagtcgagttccggggtgatcggccgcgacgga
ggcatcccgtggcatgtgcccgaggacatggcccgcttcaaggagctgaccatgggacac
accgtgatcatgggcaggcagacctgggagtcgctgcccgagaagttccgtccgctgccg
ggccgccgaaacgtcgtgctgacccggcaggccgactacgtggcggagggggccgaggtc
gtcacagcgctggaggacgcgccgctcgacgacgcctgggtgatcggcggatcgcaggtc
tacggcctggcgttgccgctggcgacccgctgcgagatcaccgaggtggatctcgacctg
caccggcaggacgaggatgcgctggcaccgcttctcgacgaggcgtgggtcgggaccgag
ggggagtggcgtgacagcgcgtcgggccttcggtaccggttctactcgtatgtgaggaaa
tga

DBGET integrated database retrieval system