KEGG   Mycobacterium gilvum Spyr1: Mspyr1_33950Help
Entry
Mspyr1_33950      CDS       T01376                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mspyr1_33950
Enzymes [BR:msp01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mspyr1_33950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3512855..3514729)
Genome map
AA seq 624 aa AA seqDB search
MTGTASPPIYPLSAVIGHDRLRLALVLCAVRPDIGGVLIRGEKGTAKSTAVRGLAQVLSA
AFAAAGDDGGQLVELPIGATEDRVVGSLDLQKVLRDGEHAFSPGLLARAHRGVLYVDEVN
LLHDHLVDVLLDAAAMGRVHIERDGVSHSHDARFVLIGTMNPEEGELRPQLLDRFGLTVD
VAASRDVDVRAEVIRTRLAYEADPVAFARRYADADADLAARIADARALVPDVVLPDNELR
RIAALCAAFDVDGMRADLVVARTAMAHAAWRGEVTVDEDDIRVAAELALPHRRRRDPFDD
PGLDPGTLDEAMEQAGESADQTPDPEPEPDPPGGGADGSADGQPPQQNSSSHPSSSTRQS
APPSPTFKTRTLVVPGVGEGAPGRRSRARNRTGSVVSATSDPDVGHGMHVFATLLAAAGR
QTRSGAVRPGPDDVHRAVREGREGNLVIFVVDASGSMAARDRMSAVSGATLSLLRDAYQR
RDKVAVITFRQQDAQVLLPPTTSVHIASRRLARFDTGGKTPLAQGLLAARDMVVRERARD
RARRSLVVVLTDGRATGGPDPLGRTRTAASRLVAEGAAAVVVDCETSYIRLDLAQELARQ
LGAPAVRLEELRAENLTALVRTAA
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcaccgcgtccccgcccatctatccgctcagcgcggtgatcgggcacgaccgt
ctccggctcgcgctcgtcctctgcgcggtgcgacccgacatcgggggagtgctgatccgc
ggggagaaggggaccgccaagtcgaccgcggtgcggggcctggcgcaggtgctctccgcg
gcgttcgcggcggcgggagacgacggcggccagttggtcgagttgccgatcggcgccacc
gaggaccgcgtcgtcggctcgttggatctgcagaaggtgctgcgtgacggtgagcacgca
ttctctcccggcctgctggcgcgcgcacaccgtggtgtcctctacgtcgacgaggtcaac
ctgctgcacgaccacctcgtcgacgtgcttctcgacgcggcggcgatgggtcgtgtgcac
atcgaacgcgacggtgtctcccacagccacgacgcccgcttcgtgctgatcggcacgatg
aatcccgaagagggagagctgcgtccgcagctgctcgaccggttcgggctcaccgtcgac
gtggcggcttcgcgcgacgtcgacgtccgcgccgaggtgatccggacccgtctggcgtat
gaggccgaccccgtggcgttcgcccggcggtacgccgacgctgacgccgacctcgccgcg
cgcatcgccgacgccagggcactggtacccgatgtggtgctgcccgacaacgagttacgg
cgcatcgccgctctgtgtgccgccttcgacgtcgacggcatgcgcgccgatctggtggtc
gcacggaccgcgatggcgcacgcggcgtggcgcggtgaggtgaccgtcgacgaggacgac
atccgggtggcagcggaactggcgctgccgcaccgccgccgccgcgatccgttcgacgat
cccgggctagatcccggcaccctcgacgaggcgatggaacaggccggcgaatccgccgac
cagacgccggatccggagcccgagccggacccgccgggaggcggagcggacggctcggcc
gacgggcagccgccccaacagaattcgtcgtcacatccatcctcatcgacgcgccagagc
gcaccgccgtcgcccaccttcaagaccaggacgctcgtcgtccccggcgtgggcgaaggc
gccccgggccggcgctcacgggcccgcaaccgcaccgggtcggtggtgtcggcgacgtcg
gacccggacgtgggccacggcatgcacgtgttcgcgacgctgctcgcggcggccggccgg
cagacccgttcgggtgcagtgcgtcccggtcccgacgacgtgcatcgtgccgtccgggaa
gggcgtgagggcaatctggtgatcttcgtcgtcgacgcctcggggtcgatggccgcccgc
gaccggatgtcggcggtcagcggagcgacgttgtcgttgctccgcgatgcctaccagcgc
agggacaaggtcgcggtcatcacgttccggcagcaggacgcgcaggtgctgctgccgccg
accacgtcggtacacatcgccagtcgccggctcgcccgcttcgacaccggcggtaaaacg
ccgctggcgcaaggacttctggccgctcgggacatggtggtccgggaacgggcgcgcgat
cgcgcgcgccgcagcctcgtcgtggtgctgaccgacgggcgcgccaccggcgggcccgac
ccgctgggccggacccggacggcggcctcgcggctggtggccgagggtgcggctgccgtc
gtggtcgactgcgaaacctcctacatcaggctcgatctcgcccaggagctggcgcggcag
ctgggtgcgccggcggtccggctggaggagttgcgggccgagaatctgaccgcgctggtg
agaaccgccgcgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system