KEGG   Mycobacterium gilvum Spyr1: Mspyr1_35900Help
Entry
Mspyr1_35900      CDS       T01376                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mspyr1_35900
   01230 Biosynthesis of amino acids
    Mspyr1_35900
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mspyr1_35900
   00030 Pentose phosphate pathway
    Mspyr1_35900
   00051 Fructose and mannose metabolism
    Mspyr1_35900
   00052 Galactose metabolism
    Mspyr1_35900
  Energy metabolism
   00680 Methane metabolism
    Mspyr1_35900
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Mspyr1_35900
Enzymes [BR:msp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mspyr1_35900
Protein phosphatases and associated proteins [BR:msp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Mspyr1_35900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3712903..3713934)
Genome map
AA seq 343 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRTCDARYGSSVVGFLDGWRGLLEDRRVQLKNDDRNDR
LLAKGGTMLGTARTNPDKLRAGLDQIKQTLEDNGIDVLIPIGGEGTLTAAHWLSEEGVPV
VGVPKTIDNDIDCTDVTFGHDTALTIATEAIDRLHSTAESHQRVMLVEVMGRHAGWIALN
AGMASGAHMTLIPEQPFDVEEVCRLVKQRFQRGDSHFICVVAEGAKPAEGSMQLRQGGMD
EFGHEKFTGVAAQLAIEVEKRIKKDVRVTVLGHVQRGGTPTAFDRVLATRFGVNAADAAH
AGEYGMMVSARGTEIGRVPLADAVRHLKLVPQTRYDDAAEFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcggagtgctgaccggcggcggagactgcccaggcctgaacgccgtgatccgg
gcggtggtccgcacctgcgacgcgcgctacggctcgtcggtcgtcggcttcctcgacggc
tggcggggtctgttggaggaccgccgcgtccagctcaagaacgacgaccgcaacgaccgg
ctgctcgccaagggcggcacgatgctgggcaccgcccggaccaacccggacaagctgcgc
gccggcctcgaccagatcaagcagacgctggaggacaacgggatcgacgtgctgatcccg
atcggcggcgagggaaccctgaccgctgcgcactggctctccgaggagggcgtgccggtg
gtgggtgtgcccaagacgatcgacaacgacatcgactgcacggacgtgactttcgggcac
gacaccgctctgaccatcgcgaccgaggccatcgaccgcctgcacagcacggccgagtcc
caccagcgcgtcatgctcgtcgaggtgatgggccgccacgccggctggatcgcgctgaac
gcgggcatggcctccggggcgcacatgacgctgatccccgagcagcccttcgatgtcgaa
gaggtgtgcagactggtcaagcagcgcttccagcgcggtgattcgcacttcatctgcgtc
gtcgccgagggcgccaaacccgccgagggttcgatgcagctgcggcagggcggcatggac
gagttcggccacgagaagttcaccggggtcgcggcgcagttggcgatcgaggtcgagaag
cgcatcaagaaggacgtccgcgtcaccgtgctcggtcacgtgcagcgcggaggcaccccg
accgcattcgaccgcgtgttggcgacccgcttcggcgtcaacgccgccgacgccgcgcac
gcgggggagtacgggatgatggtgtcggcccgcggcaccgagatcggccgggtaccgctg
gccgacgccgtgcggcatctcaagctggtcccgcagacgcgctacgacgatgccgccgaa
ttcttcggctga

DBGET integrated database retrieval system